BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31023.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 23 5.7 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 9.9 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 23.4 bits (48), Expect = 5.7 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 169 GHLQITKEKNMNIVKYCEISLFPFRDYFLLFSKF 68 GH+ I +V+ C + L+ RDY K+ Sbjct: 59 GHISIRGRILTGVVRKCIVLLYIRRDYLQFIRKY 92 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 Query: 345 GCVCYIEIPTQRSRWWXAYISNDKSSHN 428 G V + IPT++S W I D + N Sbjct: 340 GQVYFYHIPTKQSTWHDPRIPRDFDTQN 367 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,320 Number of Sequences: 2352 Number of extensions: 10417 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -