BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31023.Seq (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 1.7 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 1.7 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 3.0 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/37 (27%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 546 LSXIQW-QIKFS*HSLYLSHLAGPXTYFIDTANSWAR 439 ++ +QW ++ + SL+ H+AGP +D++ ++ R Sbjct: 507 VNSVQWPRLNPNEKSLHYLHIAGPGKIQMDSSTNFGR 543 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/37 (27%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 546 LSXIQW-QIKFS*HSLYLSHLAGPXTYFIDTANSWAR 439 ++ +QW ++ + SL+ H+AGP +D++ ++ R Sbjct: 507 VNSVQWPRLNPNEKSLHYLHIAGPGKIQMDSSTNFGR 543 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 237 LKVLCGITAASTIVSAVSYLVSKDT 163 + L I+A+ I A S LVSKD+ Sbjct: 242 INTLLSISASCVIAFATSALVSKDS 266 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,994 Number of Sequences: 438 Number of extensions: 3368 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -