BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31021.Seq (459 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_49207| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_5808| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_18984| Best HMM Match : DNA_topoisoIV (HMM E-Value=0) 30 1.1 SB_3663| Best HMM Match : MBT (HMM E-Value=0) 30 1.1 SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_37289| Best HMM Match : Herpes_teg_N (HMM E-Value=0.07) 29 1.8 SB_59693| Best HMM Match : Phage_integr_N (HMM E-Value=2.3) 28 4.3 SB_54200| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_20579| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.39) 28 4.3 SB_19759| Best HMM Match : HATPase_c (HMM E-Value=1.1e-13) 27 5.6 SB_15701| Best HMM Match : MT-A70 (HMM E-Value=1.6e-17) 27 7.5 SB_8501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 136 YGVGVVNRYALFLDDETDPLDALKAREQ 219 Y +GV NR+ L L DE DP K E+ Sbjct: 6 YSIGVNNRFGLLLSDEEDPETTFKESEK 33 >SB_49207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 30.7 bits (66), Expect = 0.61 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 219 GEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKG 320 G+ +QK+++ RK N+GKP P +K + + G Sbjct: 46 GKTSQKDEKPERKSNRGKPGPNDSKYIRLAKAGG 79 >SB_5808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 30.7 bits (66), Expect = 0.61 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 216 AGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRK 317 A +KE ++ RK+++GKP+P+ K PTRK Sbjct: 293 ATSNEKKEQEKERKKSEGKPKPRSEK-EKQPTRK 325 >SB_18984| Best HMM Match : DNA_topoisoIV (HMM E-Value=0) Length = 1182 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +3 Query: 240 DQRSRKENKGKPEPKPAKGVTVPTRKGH*GNSKCEVSXHQKWRTTE 377 D+ + K P +PAKGVT +R G +S V K +TT+ Sbjct: 1134 DEAQPGKKKAAPRKRPAKGVTAASRDGD-SDSDASVEVVSKKKTTK 1178 >SB_3663| Best HMM Match : MBT (HMM E-Value=0) Length = 327 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 207 SARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPT 311 SA + + ++E++ KE + KP+P+P +PT Sbjct: 158 SAASSDDEEEEEEEEEKEKEEKPKPEPELAPPLPT 192 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 29.5 bits (63), Expect = 1.4 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +3 Query: 201 VKSARAGEGAQKEDQRSRKENKGKPE-PKPAKGVTVPTRKGH*GNSKCEVS 350 +K+ AGEG Q++D RS E P P+P G T G G + EV+ Sbjct: 1041 IKACDAGEG-QRKDSRSGAEGAAPPPLPRPYTGAGPKTPNGE-GKPEAEVT 1089 >SB_37289| Best HMM Match : Herpes_teg_N (HMM E-Value=0.07) Length = 1248 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +3 Query: 204 KSARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGH*GNSKCEV 347 ++ R + + +RS+KENKG P+ + TV RK N+K EV Sbjct: 748 EAKRKKQRPKSSRRRSQKENKGCPKKESESEHTVEGRKYTLQNAKTEV 795 >SB_59693| Best HMM Match : Phage_integr_N (HMM E-Value=2.3) Length = 319 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 225 GAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGH 323 G Q++ S + +G+ EP+PA+ VT T +G+ Sbjct: 258 GNQQQIVDSSRATRGETEPRPAQTVTENTTRGN 290 >SB_54200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 222 EGAQKEDQRSRKENKGKPEPKPAKG 296 EG KED KE KGK E +G Sbjct: 875 EGKNKEDNEKEKEKKGKDEKDEKEG 899 >SB_20579| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.39) Length = 721 Score = 27.9 bits (59), Expect = 4.3 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +3 Query: 201 VKSARAGEGAQKEDQRSRKENKGKPEPKP 287 + SA + A++E+ +R+EN P+P+P Sbjct: 672 LSSAEPSKAAEQEETSTREENSVDPQPEP 700 >SB_19759| Best HMM Match : HATPase_c (HMM E-Value=1.1e-13) Length = 295 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 319 PFRVGTVTPLAGLGSGLP 266 P GTV PLAG G GLP Sbjct: 180 PSTSGTVAPLAGYGYGLP 197 >SB_15701| Best HMM Match : MT-A70 (HMM E-Value=1.6e-17) Length = 1178 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 225 GAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGH--*GNSKCEVSXHQKWRTTEG 380 G Q++ S + +G+ EP+PA+ T T +G+ G S E+ R G Sbjct: 889 GNQQQIVDSSRTTRGETEPRPAQTATENTTRGNATRGRSLIELCSESNLRIANG 942 >SB_8501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 543 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 Query: 201 VKSARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTR 314 +K + A + + R+ NK P P GV PTR Sbjct: 133 LKDSNAWQHRHRNRYRNETSNKPSPSPGARSGVAKPTR 170 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,752,698 Number of Sequences: 59808 Number of extensions: 205521 Number of successful extensions: 501 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -