BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31019.Seq (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) 28 3.7 SB_42660| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_58013| Best HMM Match : ABC_membrane (HMM E-Value=6.3e-28) 27 6.5 >SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) Length = 338 Score = 28.3 bits (60), Expect = 3.7 Identities = 16/55 (29%), Positives = 31/55 (56%) Frame = +2 Query: 248 KAYSRTLTTSALRLHQRIPAREISLSRDFMARFFLEDSAHYLFYSLXFMNVVPNL 412 +A+ R LT+++L H+R+ + +S + F+L S ++L +L +N P L Sbjct: 243 RAWMRRLTSNSL--HERVNYKVFKISLAIVLAFYLCYSCYWLQVTLCTLNEPPRL 295 >SB_42660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +3 Query: 183 SPCCVPLDTCSHCLTIQCRHSTKRTRER*RLQRCGYIKEFQH 308 SP C+P CSH + + H T R++ CG+ + +++ Sbjct: 53 SPSCIPDSLCSHSAS-RASHQTHSHTPYLRMRCCGWSRVYRN 93 >SB_58013| Best HMM Match : ABC_membrane (HMM E-Value=6.3e-28) Length = 951 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 362 RCPPGRTSP*NPARGRSLVLEFFDVAAALKSSA 264 RCPPGR P P + + LV FD+ +K + Sbjct: 85 RCPPGRGGPILPVKTK-LVPSLFDIDLEVKKGS 116 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,903,760 Number of Sequences: 59808 Number of extensions: 305692 Number of successful extensions: 850 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 846 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -