BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31019.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05850.1 68414.m00612 chitinase-like protein 1 (CTL1) similar... 30 0.75 At5g55090.1 68418.m06867 protein kinase family protein contains ... 27 5.3 At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1)... 27 5.3 At1g30475.1 68414.m03725 expressed protein 27 7.0 >At1g05850.1 68414.m00612 chitinase-like protein 1 (CTL1) similar to class I chitinase GI:7798656 from [Halimolobos perplexa var. perplexa]; contains Pfam profile PF00182: Chitinase class I; identical to cDNA chitinase-like protein 1 (CTL1) CTL1-ELP1 allele GI:17226328 Length = 321 Score = 30.3 bits (65), Expect = 0.75 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 145 GNDVSFQGWDAFWWTSVAC 89 GN V QGW+ WW+ C Sbjct: 38 GNKVCTQGWECSWWSKYCC 56 >At5g55090.1 68418.m06867 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 448 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 199 HWIRVPIV*QSSVGILQSVLANADDFSAAATSKNSST 309 +WIR PI+ + S + + N+ DF A +++ SS+ Sbjct: 5 NWIRGPIIGRGSTATVSLGITNSGDFFAVKSAEFSSS 41 >At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1) (FAS1) identical to FAS1 [Arabidopsis thaliana] GI:4887626 Length = 815 Score = 27.5 bits (58), Expect = 5.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 46 NFNTLNQYGRSKSASRRHWSTKRHPSLE 129 +F + Q G S+S++HW +R P E Sbjct: 401 HFASWRQLGHLLSSSKKHWGMRRQPKSE 428 >At1g30475.1 68414.m03725 expressed protein Length = 162 Score = 27.1 bits (57), Expect = 7.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 40 STNFNTLNQYGRSKSASRRHWSTKRHPSLESS 135 ++N N+ +Y S S R+ WS + PSL+ + Sbjct: 26 TSNGNSQRRYPTSVSMQRQPWSQSKFPSLQDA 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,427,509 Number of Sequences: 28952 Number of extensions: 210847 Number of successful extensions: 687 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -