BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31016.Seq (489 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 prot... 27 0.46 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 25 1.1 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 25 1.1 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 25 1.1 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 25 1.1 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 1.1 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 25 1.1 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 25 1.4 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 25 1.8 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 2.4 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 3.2 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 4.2 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 22 9.8 AY146726-1|AAO12086.1| 136|Anopheles gambiae odorant-binding pr... 22 9.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 22 9.8 >AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 protein. Length = 100 Score = 26.6 bits (56), Expect = 0.46 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 182 TYNLNFIVFANRHGFYIEFLS*FLRQGRGHQHSPY 78 T+ L ++FA R+ F + S +++GR H PY Sbjct: 27 TFGLTRLLFAGRNPFGSDLASLNIQRGRDHALRPY 61 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 454 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 335 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 454 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 335 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 454 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 335 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 454 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 335 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 454 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 335 C G C SF G F Q ALCS+ EDC +H Sbjct: 618 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 657 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 25.4 bits (53), Expect = 1.1 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = -2 Query: 320 SHTLKGECRHMLLHHWPFLFESLNVYNKLFTIHLHHFANLLAFVVSTYNLNFIVF 156 SH GE + L L E +N+L+TI LH F A +N + F Sbjct: 408 SHNQIGELSAVALQALTKLQELYLDHNQLYTIELHAFKQTTALHTLHLQVNQLAF 462 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 25.0 bits (52), Expect = 1.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 107 QGRGHQHSPYM*RSTEMPLPVFPS*G 30 Q GH HS +S +P+PVF G Sbjct: 150 QAAGHLHSSVSEKSKTVPVPVFQKVG 175 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 24.6 bits (51), Expect = 1.8 Identities = 16/69 (23%), Positives = 36/69 (52%) Frame = +3 Query: 108 SKELRQKFNVKSMPIRKDDEVQVVRGHYKGQQVGKVMQVYRKKFVVYIEGFKEKRPMVQQ 287 SKEL+ K++ + ++++DE++ + K ++ KV K I G ++K P + + Sbjct: 884 SKELKAKYHQRDKLLKQNDELK-LEIKKKENEITKVRN-ENKDGYDRISGMEQKYPWIPE 941 Query: 288 HMSAFTLQS 314 F +++ Sbjct: 942 DKEFFGVKN 950 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 24.2 bits (50), Expect = 2.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 136 TLNFCLSSLDRGEDINTRL 80 T+NFCL L + DI RL Sbjct: 319 TMNFCLYELAKNPDIQGRL 337 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.8 bits (49), Expect = 3.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 136 TLNFCLSSLDRGEDINTRL 80 T+NFCL L + DI RL Sbjct: 320 TMNFCLYELAKHPDIQERL 338 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 4.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 280 CNSICRHSPFKVCDCQVE 333 C ++C F CDC++E Sbjct: 740 CFALCHCCDFYACDCKME 757 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 22.2 bits (45), Expect = 9.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 296 GIHPSKCVIVK 328 G HPSKCV ++ Sbjct: 64 GAHPSKCVTIQ 74 >AY146726-1|AAO12086.1| 136|Anopheles gambiae odorant-binding protein AgamOBP19 protein. Length = 136 Score = 22.2 bits (45), Expect = 9.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 213 VMQVYRKKFVVYIEGFKEKRPMVQQHM 293 +MQV RK V Y + K+ M+ HM Sbjct: 68 IMQVARKGKVNYEKSLKQIDTMLPDHM 94 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.2 bits (45), Expect = 9.8 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = +1 Query: 280 CNSICRHSPFKVCDCQV 330 C ++C F CDC++ Sbjct: 776 CFALCHCCEFDACDCEM 792 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 521,555 Number of Sequences: 2352 Number of extensions: 11674 Number of successful extensions: 30 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -