BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV31001.Seq (465 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 2.8 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 6.5 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 22.2 bits (45), Expect = 2.8 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -3 Query: 307 PIPSNSCF*IKSG--NTNRRRGWQSPRCQPCCRERAE 203 PIPS +C S + + WQ R CC+E E Sbjct: 47 PIPSYACRGRCSSYLQVSGSKIWQMERSCMCCQESGE 83 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/21 (28%), Positives = 14/21 (66%) Frame = -3 Query: 433 IFLEKFPDRWELEICSYQNWL 371 +F +++P +W L IC + ++ Sbjct: 93 VFWQQYPWQWGLGICKLRAYV 113 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,654 Number of Sequences: 438 Number of extensions: 2799 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12436029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -