BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30991.Seq (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces... 25 5.6 SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo... 25 5.6 SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 5.6 >SPBC1198.04c |zas1||zinc finger protein Zas1|Schizosaccharomyces pombe|chr 2|||Manual Length = 897 Score = 25.4 bits (53), Expect = 5.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 276 WTDTKNELSTQKNQIELLQFCRRDFFSSEPPY 181 W +T+N + N +E+L R+ S P Y Sbjct: 764 WANTENARYSTSNALEILDMLLREKIESAPRY 795 >SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 1616 Score = 25.4 bits (53), Expect = 5.6 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -1 Query: 287 NAWDGPILKMNCQRRRIR*NYCSFAAGTFFPRNRPTSD 174 N W P L++NC + Y + G+F+ + R T D Sbjct: 1434 NLWK-PHLQLNCLSDEVAQYYITLCKGSFYYQMRNTED 1470 >SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 628 Score = 25.4 bits (53), Expect = 5.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 372 WVLSWATHALRDLRQWPPPXVYF 440 W L+ A D+R WPP ++F Sbjct: 403 WTLTDLADAFLDVRLWPPIFMFF 425 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,887,857 Number of Sequences: 5004 Number of extensions: 31472 Number of successful extensions: 64 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -