BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30991.Seq (548 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U38378-4|AAA79749.1| 502|Caenorhabditis elegans Hypothetical pr... 33 0.10 U23523-1|AAC46560.2| 305|Caenorhabditis elegans Hypothetical pr... 27 8.9 >U38378-4|AAA79749.1| 502|Caenorhabditis elegans Hypothetical protein R11F4.1 protein. Length = 502 Score = 33.5 bits (73), Expect = 0.10 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -3 Query: 534 LLADGGMAQTQFLMQMQADLXGIPXIRPLMMESTPXGAAIVAG 406 L DGGM + ++QAD+ G + P + E + GAA+ G Sbjct: 411 LKVDGGMIANKLFNEIQADIMGRDIVTPKITEISGWGAAVAGG 453 >U23523-1|AAC46560.2| 305|Caenorhabditis elegans Hypothetical protein F53A9.5 protein. Length = 305 Score = 27.1 bits (57), Expect = 8.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 443 WKVHPWGRPLSQVAQC 396 W+ PW P+S +AQC Sbjct: 121 WRSTPWTLPISNIAQC 136 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,762,092 Number of Sequences: 27780 Number of extensions: 192656 Number of successful extensions: 305 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 305 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -