BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30990.Seq (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59240.1 68418.m07424 40S ribosomal protein S8 (RPS8B) 40S ri... 109 5e-25 At5g20290.1 68418.m02415 40S ribosomal protein S8 (RPS8A) riboso... 109 7e-25 At2g22830.1 68415.m02711 squalene monooxygenase, putative / squa... 31 0.28 At3g28560.1 68416.m03566 hypothetical protein similar to mitocho... 30 0.65 At5g44010.1 68418.m05386 expressed protein 29 0.86 At4g04400.1 68417.m00634 hypothetical protein contains Pfam prof... 28 2.6 At3g46650.1 68416.m05064 UDP-glucoronosyl/UDP-glucosyl transfera... 27 4.6 At2g02950.1 68415.m00242 phytochrome kinase substrate 1 (PKS1) i... 27 4.6 At5g50390.1 68418.m06241 pentatricopeptide (PPR) repeat-containi... 26 8.0 At2g21650.1 68415.m02575 myb family transcription factor contain... 26 8.0 At1g63900.1 68414.m07235 zinc finger (C3HC4-type RING finger) fa... 26 8.0 >At5g59240.1 68418.m07424 40S ribosomal protein S8 (RPS8B) 40S ribosomal protein S8, Prunus armeniaca, EMBL:AF071889 Length = 210 Score = 109 bits (263), Expect = 5e-25 Identities = 53/76 (69%), Positives = 59/76 (77%), Gaps = 1/76 (1%) Frame = +1 Query: 31 MGISRDHWHKRRATGGKRAPIRKKRKYELGRPAANTRLGPQR-IHSVRSRGGNTKYRALR 207 MGISRD HKRRATGGK+ RKKRKYELGR ANT+L + + +R RGGN K+RALR Sbjct: 1 MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALR 60 Query: 208 LDTGNFSWGSECSTRK 255 LDTGNFSWGSE TRK Sbjct: 61 LDTGNFSWGSEAVTRK 76 Score = 72.5 bits (170), Expect = 9e-14 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +3 Query: 252 QTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLG 395 +TRI+DV YNASNNELVRT+TLVK+AIV VDA PF+Q Y HY + +G Sbjct: 76 KTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQGYLQHYGVDIG 123 >At5g20290.1 68418.m02415 40S ribosomal protein S8 (RPS8A) ribosomal protein S8 - Zea mays, PIR:T04088 Length = 222 Score = 109 bits (262), Expect = 7e-25 Identities = 51/76 (67%), Positives = 60/76 (78%), Gaps = 1/76 (1%) Frame = +1 Query: 31 MGISRDHWHKRRATGGKRAPIRKKRKYELGRPAANTRLGPQR-IHSVRSRGGNTKYRALR 207 MGISRD HKRRATGGK+ RKKRKYE+GR ANT+L + + +R RGGN K+RALR Sbjct: 1 MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPANTKLSSNKTVRRIRVRGGNVKWRALR 60 Query: 208 LDTGNFSWGSECSTRK 255 LDTGN+SWGSE +TRK Sbjct: 61 LDTGNYSWGSEATTRK 76 Score = 83.0 bits (196), Expect = 7e-17 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +3 Query: 252 QTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLG 395 +TR++DVVYNASNNELVRTKTLVK+AIV VDA PF+QWY SHY + LG Sbjct: 76 KTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYGVELG 123 >At2g22830.1 68415.m02711 squalene monooxygenase, putative / squalene epoxidase, putative similar to SP|O65404 (SE 1,1), SP|O65402 (SE 1,2), SP|O65403 (SE 2) Length = 585 Score = 31.1 bits (67), Expect = 0.28 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -3 Query: 376 CDSYHCLNGVASTTTIAFLTRVFVRTNSLLDALYTTSMIRVCELNIPIP 230 C Y L GV S+ +A L+ + R SL+ + ++ VC L +P P Sbjct: 492 CFDYLSLGGVFSSGPVALLSGLNPRPLSLVLHFFAVAIYAVCRLMLPFP 540 >At3g28560.1 68416.m03566 hypothetical protein similar to mitochondrial protein-like protein (GI:11559424) [Cucumis sativus] Length = 257 Score = 29.9 bits (64), Expect = 0.65 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 10 FFFDPTKMGISRDHWHKRRATGGK--RAPIRKKRKYELGRPAANTRLGPQR 156 F DP K ++ W KRR G+ R R K++ +LGR R+ +R Sbjct: 206 FAMDPEKNKAEKEAWKKRRRKRGRLLRKKRRTKQRRKLGRRRRKQRMQRRR 256 >At5g44010.1 68418.m05386 expressed protein Length = 357 Score = 29.5 bits (63), Expect = 0.86 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = -2 Query: 326 ILDKGLCTHQFIVRCIIHNINDTGLRV--EHSDPQEKLPVSRRSARYL 189 I+D LC Q +V C+ + +TGL++ +H +P+E L A +L Sbjct: 98 IIDGKLCKRQSVVSCV--SALETGLKILSKHIEPKESLHREDNDATFL 143 >At4g04400.1 68417.m00634 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 735 Score = 27.9 bits (59), Expect = 2.6 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 332 NCILDKGLCTHQFIVRCIIHNINDTGL-RVEHSDPQEKLP 216 N I KG+C RCI++ I+D + +E+ P+ +P Sbjct: 530 NMIWWKGMCEMDISSRCIVNEISDEEVHEIENEVPETAVP 569 >At3g46650.1 68416.m05064 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 438 Score = 27.1 bits (57), Expect = 4.6 Identities = 14/57 (24%), Positives = 24/57 (42%) Frame = -2 Query: 350 SCIYYNNCILDKGLCTHQFIVRCIIHNINDTGLRVEHSDPQEKLPVSRRSARYLVFP 180 +CI Y+ + G +F + +I + V H D Q+K+ + RY P Sbjct: 109 ACIIYDEYMYFCGAAAKEFSIPSVIFSTQSAANYVSHPDMQDKVVENLYPLRYKDLP 165 >At2g02950.1 68415.m00242 phytochrome kinase substrate 1 (PKS1) identical to Swiss-Prot:Q9SWI1 phytochrome kinase substrate 1 [Arabidopsis thaliana] Length = 439 Score = 27.1 bits (57), Expect = 4.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 85 APIRKKRKYELGRPAANTRLGPQRIHSVRSRGGN 186 +P+R+ R ++ R + PQR S S GGN Sbjct: 339 SPVRRNRPTQIPRIPITAKSAPQRRKSSSSSGGN 372 >At5g50390.1 68418.m06241 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 701 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/56 (19%), Positives = 29/56 (51%) Frame = -2 Query: 362 LPEWSCIYYNNCILDKGLCTHQFIVRCIIHNINDTGLRVEHSDPQEKLPVSRRSAR 195 +PE + + +NN I L + C+++++ D+G+ ++ + +S + A+ Sbjct: 285 MPEKTTVAWNNVIAGYALHGYSEEALCLLYDMRDSGVSIDQFTLSIMIRISTKLAK 340 >At2g21650.1 68415.m02575 myb family transcription factor contains PFAM profile: PF00249 myb-like DNA-binding domain Length = 101 Score = 26.2 bits (55), Expect = 8.0 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 46 DHWHK-RRATGGKRAPIRKKRKYEL 117 D WH RA GGK P KR+Y+L Sbjct: 35 DRWHNVARAVGGK-TPEEAKRQYDL 58 >At1g63900.1 68414.m07235 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 343 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 272 CV*CI*Q*IGAYKDPCQECNCCSRCNS 352 CV C+ Q A PC CC+ C+S Sbjct: 296 CVICLEQEYNAVFVPCGHMCCCTACSS 322 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,914,234 Number of Sequences: 28952 Number of extensions: 216750 Number of successful extensions: 568 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -