BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30989.Seq (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41274-7|AAA82463.1| 1610|Caenorhabditis elegans Hypothetical pr... 30 0.68 AL032652-8|CAA21706.1| 277|Caenorhabditis elegans Hypothetical ... 28 2.7 >U41274-7|AAA82463.1| 1610|Caenorhabditis elegans Hypothetical protein T04G9.1 protein. Length = 1610 Score = 30.3 bits (65), Expect = 0.68 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +1 Query: 256 TGYPLAINATDIKV-KEVDFNPEFISRVIPKLDWEVLWVAADS 381 T Y L + +K+ +E+D NP ++ PK+D L++AADS Sbjct: 1159 TEYLLLLAEVKVKLFEEIDVNPRVREQLRPKIDLIDLYMAADS 1201 >AL032652-8|CAA21706.1| 277|Caenorhabditis elegans Hypothetical protein Y63D3A.10 protein. Length = 277 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/36 (33%), Positives = 25/36 (69%), Gaps = 3/36 (8%) Frame = +1 Query: 313 NPEFISRVIPKLDWEVLWV---AADSSATVMVCQDL 411 NP+ + ++I KLD +VLW+ +++S T+ V +++ Sbjct: 128 NPQNLLKIIGKLDLKVLWIFFNFSENSTTISVYREI 163 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,814,405 Number of Sequences: 27780 Number of extensions: 149471 Number of successful extensions: 304 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 304 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -