BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30987.Seq (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 153 4e-39 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 153 4e-39 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 153 4e-39 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 31 0.033 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 0.94 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 2.2 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 2.9 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 5.0 U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 23 8.8 AY745225-1|AAU93492.1| 156|Anopheles gambiae cytochrome P450 pr... 23 8.8 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 153 bits (371), Expect = 4e-39 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = +2 Query: 257 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 436 AAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN ANV Sbjct: 21 AAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANV 80 Query: 437 IRYFPTQALNFAFKDKYKQVFLGGLTR 517 IRYFPTQALNFAFKD YKQVFLGG+ + Sbjct: 81 IRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 35.5 bits (78), Expect = 0.001 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 284 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 463 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 464 NFAFKDKYK 490 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 32.7 bits (71), Expect = 0.008 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 198 MSNLADPVAFAKDFLAGGI 254 M+ ADP FAKDFLAGGI Sbjct: 1 MTKKADPYGFAKDFLAGGI 19 Score = 22.6 bits (46), Expect = 8.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 525 FWRYFAGN 548 FWRYF GN Sbjct: 111 FWRYFLGN 118 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 153 bits (371), Expect = 4e-39 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = +2 Query: 257 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 436 AAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN ANV Sbjct: 21 AAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANV 80 Query: 437 IRYFPTQALNFAFKDKYKQVFLGGLTR 517 IRYFPTQALNFAFKD YKQVFLGG+ + Sbjct: 81 IRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 35.5 bits (78), Expect = 0.001 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +2 Query: 284 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 463 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 464 NFAFKDKYK 490 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 32.7 bits (71), Expect = 0.008 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 198 MSNLADPVAFAKDFLAGGI 254 M+ ADP FAKDFLAGGI Sbjct: 1 MTKKADPYGFAKDFLAGGI 19 Score = 22.6 bits (46), Expect = 8.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 525 FWRYFAGN 548 FWRYF GN Sbjct: 111 FWRYFLGN 118 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 153 bits (371), Expect = 4e-39 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = +2 Query: 257 AAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANV 436 AAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD FVRIPKEQG+ +FWRGN ANV Sbjct: 21 AAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLANV 80 Query: 437 IRYFPTQALNFAFKDKYKQVFLGGLTR 517 IRYFPTQALNFAFKD YKQVFLGG+ + Sbjct: 81 IRYFPTQALNFAFKDVYKQVFLGGVDK 107 Score = 36.7 bits (81), Expect = 5e-04 Identities = 22/69 (31%), Positives = 40/69 (57%) Frame = +2 Query: 284 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 463 P + V+ + +Q S + ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SGRAKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 464 NFAFKDKYK 490 F D+ K Sbjct: 289 VLVFYDEVK 297 Score = 32.7 bits (71), Expect = 0.008 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 198 MSNLADPVAFAKDFLAGGI 254 M+ ADP FAKDFLAGGI Sbjct: 1 MTKKADPYGFAKDFLAGGI 19 Score = 22.6 bits (46), Expect = 8.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 525 FWRYFAGN 548 FWRYF GN Sbjct: 111 FWRYFLGN 118 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 30.7 bits (66), Expect = 0.033 Identities = 26/67 (38%), Positives = 34/67 (50%) Frame = +1 Query: 178 RSHNRTKCRTSPIRSRSLRTSWLAVSRRRLQDRRSTHRACQAAAPSTARQQADRRRPALQ 357 +S +R+K RTS RSRS RT A R + R T + AA + A + RRR + Sbjct: 444 QSRSRSKTRTS--RSRS-RTPLPARGHVRARLTRRTIPPTRVAAAAAAPEGRRRRRAIAR 500 Query: 358 GYRRRLR 378 RRR R Sbjct: 501 ARRRRCR 507 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 22.6 bits (46), Expect(2) = 0.94 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 371 RRRYPCNAGRR 339 RRRYP NAG + Sbjct: 346 RRRYPTNAGHK 356 Score = 21.4 bits (43), Expect(2) = 0.94 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -1 Query: 428 RSYHARMKGDPAPWGCARRRRRYP 357 R R++ P P R RRR P Sbjct: 315 REAAGRLRTGPVPGAAERHRRRRP 338 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 24.6 bits (51), Expect = 2.2 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 247 AVSRRRLQDRRSTHRACQAAAPSTA-RQQADRRRPALQGYRRRLR 378 A + RR ++RR+ A+P TA R+ A R R A RRR R Sbjct: 1117 AATARRREERRAGLPPTPPASPRTAQRRAALRERQARFRERRRNR 1161 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 24.2 bits (50), Expect = 2.9 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 229 LRTSWLAVSRRRLQDRRSTHRACQAAAPSTARQQADRRRPALQGYRRRLR 378 LRTS+L ++RR+ + AA ++ D RP L+ Y RR R Sbjct: 73 LRTSFLVINRRKFETFFE-----GVAAEYALLEKNDDIRPVLERYTRRGR 117 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 30 EFQKRHTPTLCAPVITKLLQ 89 EFQ+R TP + +++K+ Q Sbjct: 350 EFQRRLTPAMIGELVSKMTQ 369 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 146 ATPTSTYSPSEDHIIEQNVEP 208 A PT+ P EDH + ++P Sbjct: 434 ADPTAVIFPHEDHYSQPQLQP 454 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 22.6 bits (46), Expect = 8.8 Identities = 12/47 (25%), Positives = 16/47 (34%) Frame = +1 Query: 208 SPIRSRSLRTSWLAVSRRRLQDRRSTHRACQAAAPSTARQQADRRRP 348 SP R+R +SW D R C +Q +RP Sbjct: 85 SPSRTRRSSSSWAMEFDEETVDGRMVKSVCTFDGNKLIHEQKGEKRP 131 >AY745225-1|AAU93492.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 22.6 bits (46), Expect = 8.8 Identities = 12/49 (24%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +2 Query: 29 RISKKAHTYP-LCSRDYEITPNLLFKNQELVFRDPPSACAATPTSTYSP 172 R+ T P +C++DYE+ P + + R S Y P Sbjct: 72 RMHTPVFTLPRICTQDYELPPQFPTDTKRITLRRGTSVIIPVYAIHYDP 120 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 563,485 Number of Sequences: 2352 Number of extensions: 11204 Number of successful extensions: 29 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -