BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30986.Seq (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 31 0.005 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 30 0.012 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 5.4 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 7.1 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 7.1 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 31.5 bits (68), Expect = 0.005 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 394 PSRLMLPKGTYDGFPFQLFVFVYPY 320 P ++LPKGT G+P LFV + Y Sbjct: 582 PQHMLLPKGTEAGYPCHLFVMISNY 606 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 30.3 bits (65), Expect = 0.012 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 394 PSRLMLPKGTYDGFPFQLFVFVYPYE 317 P +++PKGT +G QLFV + Y+ Sbjct: 583 PQHMLIPKGTPEGMKSQLFVMISNYD 608 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.4 bits (43), Expect = 5.4 Identities = 17/66 (25%), Positives = 31/66 (46%) Frame = -2 Query: 280 VPDNKPFGYHSIAPFFLSTSNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIR 101 +PD K G HS+ L TS + S ++ S +YL T + + + + L+ Sbjct: 215 MPDIKKKGLHSLPRLVLFTSEDAHYSIKKLASFQGIGTDNVYL-IRTDARGRMDVSHLVE 273 Query: 100 KSKRTL 83 + +R+L Sbjct: 274 EIERSL 279 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.0 bits (42), Expect = 7.1 Identities = 6/21 (28%), Positives = 14/21 (66%) Frame = -1 Query: 209 MFFKKVLVYHEGELFPYLFNI 147 ++F +++VY + P L+N+ Sbjct: 333 LYFCRIMVYLNSAINPILYNL 353 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.0 bits (42), Expect = 7.1 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -2 Query: 232 LSTSNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNA 110 L N +T SW+ + SP+Y + L + N NA Sbjct: 193 LDVINVMTYDFHGSWAGVTAQNSPLYASPLDGEWQRDNLNA 233 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,842 Number of Sequences: 336 Number of extensions: 2647 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -