BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30986.Seq (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 31 0.67 At1g10760.1 68414.m01231 starch excess protein (SEX1) identical ... 29 2.0 At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransfera... 29 2.7 At3g07980.1 68416.m00975 protein kinase, putative similar to MAP... 28 4.7 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 30.7 bits (66), Expect = 0.67 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 300 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 416 D +G G+YG N +V + +SLE IV E+LN Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLN 62 >At1g10760.1 68414.m01231 starch excess protein (SEX1) identical to SEX1 [Arabidopsis thaliana] GI:12044358; supporting cDNA gi|12044357|gb|AF312027.1|AF312027 Length = 1399 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +3 Query: 279 TTDLNGSDSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSV 425 T+DL G+ S +G Y SW G P+ V L E ++SE+ N +V Sbjct: 1089 TSDLVGAKSRNIG-YLKGKVPSWVGIPTSVALPFGVFEKVISEKANQAV 1136 >At5g14580.1 68418.m01710 polyribonucleotide nucleotidyltransferase, putative similar to Swiss-Prot:P05055 polyribonucleotide nucleotidyltransferase (EC 2.7.7.8) (Polynucleotide phosphorylase) (PNPase) [Escherichia coli] Length = 991 Score = 28.7 bits (61), Expect = 2.7 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 10/60 (16%) Frame = -2 Query: 313 TPKESEPFKSVVPDN---------KPFG-YHSIAPFFLSTSNNLTCSSRRSWSTMKENYS 164 T KE E +S+ P+ K G S++P ST++NL S+ STMKEN S Sbjct: 848 TQKEEEALESIAPEETSAECGEILKQDGKLKSVSPKNNSTASNLVSFSKAKKSTMKENLS 907 >At3g07980.1 68416.m00975 protein kinase, putative similar to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1367 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 300 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELN 416 D +G G+YG N +V + +SLE I E+LN Sbjct: 24 DEIGKGAYGRVYIGLDLENGDFVAIKQVSLENIGQEDLN 62 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,060,407 Number of Sequences: 28952 Number of extensions: 231759 Number of successful extensions: 640 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 640 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -