BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30982.Seq (349 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5ILE4 Cluster: Sulfatase; n=2; Thermotoga|Rep: Sulfata... 31 4.1 >UniRef50_A5ILE4 Cluster: Sulfatase; n=2; Thermotoga|Rep: Sulfatase - Thermotoga petrophila RKU-1 Length = 593 Score = 31.5 bits (68), Expect = 4.1 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = +1 Query: 16 KIVLYQNFIPTYHNSILVTIFTKSAWLISVLXTXKXXXLLLF*RNISLIFFIHF 177 KIVL+ ++PT + + +F+ + WL+ +L K LL+ +SL+ F+ F Sbjct: 13 KIVLF--YVPTLSSFSVSVVFSTAGWLMLLLLVFKGGHKLLY-TVLSLLLFVDF 63 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,154,355 Number of Sequences: 1657284 Number of extensions: 2846364 Number of successful extensions: 5375 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5375 length of database: 575,637,011 effective HSP length: 89 effective length of database: 428,138,735 effective search space used: 11131607110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -