BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30982.Seq (349 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U49947-1|AAA93420.2| 232|Caenorhabditis elegans Hypothetical pr... 27 3.7 AF078157-3|AAG24079.1| 119|Caenorhabditis elegans Hypothetical ... 27 4.9 Z66497-7|CAE17887.1| 197|Caenorhabditis elegans Hypothetical pr... 26 8.5 AF163019-1|AAD49324.1| 1312|Caenorhabditis elegans trithorax-rel... 26 8.5 AF039718-1|AAB96746.1| 1312|Caenorhabditis elegans Abnormal cell... 26 8.5 >U49947-1|AAA93420.2| 232|Caenorhabditis elegans Hypothetical protein C30G4.2 protein. Length = 232 Score = 27.1 bits (57), Expect = 3.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 57 VMVGRYKILIQNDFXTSMN 1 + VGRYKIL+ D+ SM+ Sbjct: 126 ITVGRYKILVNKDYLMSMS 144 >AF078157-3|AAG24079.1| 119|Caenorhabditis elegans Hypothetical protein F25E5.9 protein. Length = 119 Score = 26.6 bits (56), Expect = 4.9 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 341 LVRDSIQRDXCSACSGVRPAN-SSGVCMSRPXRCLXLXLQLXEHRS 207 L S RD C+ C G +P + S CM P + + L + R+ Sbjct: 45 LPSSSFCRDLCAICGGAKPTSLSIEECMCAPHSFFLVSVVLLKRRT 90 >Z66497-7|CAE17887.1| 197|Caenorhabditis elegans Hypothetical protein K08F8.7 protein. Length = 197 Score = 25.8 bits (54), Expect = 8.5 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 23 FCIKILYLPTITRYWSQFSLKVLGLL 100 FCI ++++ +++YW+ V GLL Sbjct: 32 FCIIVIFIIGLSQYWTNRVSAVFGLL 57 >AF163019-1|AAD49324.1| 1312|Caenorhabditis elegans trithorax-related protein LIN-59 protein. Length = 1312 Score = 25.8 bits (54), Expect = 8.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 102 TNKPSTFSENCDQYRVMVGRYKILI 28 T +P ENCD YR ++ R I + Sbjct: 1040 TEQPDVRFENCDYYRSLINRRGIQV 1064 >AF039718-1|AAB96746.1| 1312|Caenorhabditis elegans Abnormal cell lineage protein 59 protein. Length = 1312 Score = 25.8 bits (54), Expect = 8.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 102 TNKPSTFSENCDQYRVMVGRYKILI 28 T +P ENCD YR ++ R I + Sbjct: 1040 TEQPDVRFENCDYYRSLINRRGIQV 1064 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,474,259 Number of Sequences: 27780 Number of extensions: 70303 Number of successful extensions: 162 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 461821634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -