BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30979.Seq (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.3 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.1 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.1 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 4.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.1 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/28 (28%), Positives = 11/28 (39%) Frame = -3 Query: 353 YSGVLGDFILYRCSCLSFKWNFTSPVLC 270 Y G+ Y C W T+P +C Sbjct: 476 YDGIRDMIGYYPCCWWKICWTITTPAIC 503 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/28 (28%), Positives = 11/28 (39%) Frame = -3 Query: 353 YSGVLGDFILYRCSCLSFKWNFTSPVLC 270 Y G+ Y C W T+P +C Sbjct: 529 YDGIRDMIGYYPCCWWKICWTITTPAIC 556 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 487 ETGQVLVRILPIDVNTTNDVNRDLDSIKQYCPVLLF 380 +T ++L +LPI V +R + + K C LLF Sbjct: 379 KTDRLLYSVLPISVANELRHSRPVPAKKYDCVTLLF 414 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 487 ETGQVLVRILPIDVNTTNDVNRDLDSIKQYCPVLLF 380 +T ++L +LPI V +R + + K C LLF Sbjct: 379 KTDRLLYSVLPISVANELRHSRPVPAKKYDCVTLLF 414 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/29 (37%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 465 VSCP*TSTQLMMLTVI*IASNN-TVPYCS 382 ++C T+T+L T I +A NN T+ +C+ Sbjct: 321 IACWDTNTELNPNTFILVAENNTTMVFCN 349 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 1 ESNLKCIHFIFKEHNRVVVHYTRPDSF 81 E+N+ +H ++ +V H+T +SF Sbjct: 343 EANVAVLHSFQMKNVTIVDHHTASESF 369 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,950 Number of Sequences: 438 Number of extensions: 3324 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -