BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30978.Seq (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 27 0.47 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 5.8 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 26.6 bits (56), Expect = 0.47 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +3 Query: 216 AGEGAQKEDQRSRKENKGKPEPKPAKGVTVPXRK-GIKXTQNVKSQDIXSGEQQKGKG 386 A EGA K ++ ++G+P PKP + +T ++ +K + V + + QQ G G Sbjct: 130 AAEGAPKPQRKL--SDRGEPPPKPDRRITTTTQQIVVKLPETVANVSLE--HQQSGAG 183 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.0 bits (47), Expect = 5.8 Identities = 12/55 (21%), Positives = 24/55 (43%) Frame = +3 Query: 225 GAQKEDQRSRKENKGKPEPKPAKGVTVPXRKGIKXTQNVKSQDIXSGEQQKGKGP 389 G Q+ R+R E + + + ++ IK +++ QD+ + G GP Sbjct: 303 GMQRRFNRARTEEQREERRQIKSDARAALQQAIKLSKDQHKQDLPEQLEPHGFGP 357 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 376,104 Number of Sequences: 2352 Number of extensions: 5798 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -