BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30976.Seq (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Sch... 26 3.2 SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizo... 26 3.2 SPCC1919.03c |||AMP-activated protein kinase beta subunit |Schiz... 26 4.2 SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase... 25 5.6 SPBP8B7.25 |cyp4||cyclophilin family peptidyl-prolyl cis-trans i... 25 7.3 SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomy... 25 9.7 >SPBC11C11.09c |rpl502|rpl5-2, rpl5b|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 2|||Manual Length = 294 Score = 26.2 bits (55), Expect = 3.2 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = -1 Query: 179 KENYSPIYLTFLTIHQIKRNYNA-----LIRKSKRTLTITVYNSRISCEYV 42 +E + Y I Q K YNA ++R S R +T + +SR++ +YV Sbjct: 24 REGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYV 74 >SPAC3H5.12c |rpl501|rpl5-1, rpl5|60S ribosomal protein L5|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 26.2 bits (55), Expect = 3.2 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = -1 Query: 179 KENYSPIYLTFLTIHQIKRNYNA-----LIRKSKRTLTITVYNSRISCEYV 42 +E + Y I Q K YNA ++R S R +T + +SR++ +YV Sbjct: 24 REGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYV 74 >SPCC1919.03c |||AMP-activated protein kinase beta subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 298 Score = 25.8 bits (54), Expect = 4.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 314 SXHTXRRXQTAGRGIHRMY 370 S HT RR QT+G+ H+ Y Sbjct: 76 SGHTKRRSQTSGKKTHQPY 94 >SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase Gpt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1448 Score = 25.4 bits (53), Expect = 5.6 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -2 Query: 511 RFIYXLAFFKKTLSRWPKSTSSWTKE 434 R I L+ + KTL P STSS TKE Sbjct: 838 RAISFLSSYLKTLESTPMSTSSPTKE 863 >SPBP8B7.25 |cyp4||cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 201 Score = 25.0 bits (52), Expect = 7.3 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Frame = -1 Query: 311 PKESEPFKSVVPDNKPFGY-----HSIAPFFLSTSNNLT 210 PK +E F+++ K FGY H + P F+ ++T Sbjct: 53 PKTAENFRALATGEKGFGYEGSIFHRVIPNFMIQGGDIT 91 >SPCC417.07c |mto1|mbo1, mod20|MT organizer Mto1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1115 Score = 24.6 bits (51), Expect = 9.7 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -1 Query: 326 PYXPTPKESEPFKSVVPDNKPF--GYHSIAPFFLSTSN 219 P TP +S P +SV N G S+APFFL T+N Sbjct: 86 PTSSTPLQS-PDESVNKLNSEDEEGNSSVAPFFLDTTN 122 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,970,098 Number of Sequences: 5004 Number of extensions: 36582 Number of successful extensions: 83 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -