BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30974.Seq (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 9e-26 SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) 31 0.79 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_7019| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 27 9.7 SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 9.7 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 113 bits (272), Expect = 9e-26 Identities = 53/63 (84%), Positives = 58/63 (92%) Frame = +2 Query: 257 IRQAISKALIAFYQKYVDEASKKGIKDILVQYDRSLLVADPRRCEPKKFGGPXARARYQK 436 IRQAISK+L+A+YQKYVDE SKK I+DILVQYDRSLLVADPRR E KKFGGP AR+RYQK Sbjct: 45 IRQAISKSLVAYYQKYVDEVSKKEIRDILVQYDRSLLVADPRRTEAKKFGGPGARSRYQK 104 Query: 437 SYR 445 SYR Sbjct: 105 SYR 107 Score = 54.8 bits (126), Expect(2) = 2e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 156 KLQEPILLLGKEKFSMVDIRVTVKGGGHVAQVY 254 K++EPILLLGKE+F VDIRV VKGGGH +++Y Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIY 43 Score = 20.6 bits (41), Expect(2) = 2e-08 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 30 QAVQVFGRK 56 Q+VQVFGRK Sbjct: 3 QSVQVFGRK 11 >SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) Length = 119 Score = 30.7 bits (66), Expect = 0.79 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 233 WSCSTSLPIRQAIS-KALIAFYQKYVDEASKKGIKDILVQYDRSLLVADPRRCE 391 W + L ++ ++AF QKY+D +K +Q+ + +LV+ R CE Sbjct: 36 WDRALELAVKHKTHVDTVLAFRQKYLDNFGRKETSKRFLQFAQGVLVSLARECE 89 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -3 Query: 200 REFFLAEQKDRFLKFVLQQSGLNQ--VQWAP 114 R F + KDR+LK L++ G Q QW P Sbjct: 12 RSFLFTQDKDRYLKAGLKKYGYGQWTAQWVP 42 >SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +2 Query: 92 SWNAACKRAPIGLG*AQTAAVQTSGTYPFARQGKILYG 205 SW A K+ P G G ++ +G Y R G+ YG Sbjct: 19 SWQNAEKKKPAGFGRGRSKRGYVNGNYEARRPGERSYG 56 >SB_7019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 360 LLSYCTRMSLIPFFEASSTYFW 295 L+S C R+S PF ASS + W Sbjct: 276 LVSTCRRLSSTPFASASSNHSW 297 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 27.1 bits (57), Expect = 9.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 311 EASKKGIKDILVQYDRSLLVADPRRC 388 E KKG KD+ + Y+ + +A R+C Sbjct: 506 EIEKKGEKDLRISYEERMTMAKIRKC 531 >SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4277 Score = 27.1 bits (57), Expect = 9.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -3 Query: 443 GKISGIWHGHXDHRTSWARSDAGQP 369 G+++G W ++R W + D G+P Sbjct: 864 GRMAGCWAARHNNRKQWLQVDLGKP 888 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,894,780 Number of Sequences: 59808 Number of extensions: 368523 Number of successful extensions: 931 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -