BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30973.Seq (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61215.1 68414.m06898 DNA-binding bromodomain-containing prot... 31 0.58 At1g58070.1 68414.m06581 expressed protein 29 2.4 At3g15600.1 68416.m01976 hypothetical protein low similarity to ... 29 3.1 At3g23980.1 68416.m03012 dentin sialophosphoprotein-related cont... 28 4.1 At2g22560.1 68415.m02674 kinase interacting protein-related simi... 28 4.1 At3g47400.1 68416.m05154 pectinesterase family protein similar t... 27 7.2 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 27 7.2 At3g44740.1 68416.m04816 tRNA synthetase class II (G, H, P and S... 27 7.2 At1g29880.1 68414.m03652 glycyl-tRNA synthetase / glycine--tRNA ... 27 7.2 At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almos... 27 9.5 At4g17730.1 68417.m02647 syntaxin 23 (SYP23) / PEP12-like protei... 27 9.5 At2g45900.1 68415.m05708 expressed protein 27 9.5 At1g44080.1 68414.m05088 F-box protein-related / C-type lectin-r... 27 9.5 At1g03990.1 68414.m00385 alcohol oxidase-related low similarity ... 27 9.5 >At1g61215.1 68414.m06898 DNA-binding bromodomain-containing protein contains Pfam profile PF00439: Bromodomain Length = 475 Score = 31.1 bits (67), Expect = 0.58 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = -2 Query: 168 EDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRD 58 E K+KR+ L+AALLK++ + L+S+ +++ S D Sbjct: 75 ELKKKRVAELKAALLKSEDSIGSLESKLQSLKSESND 111 >At1g58070.1 68414.m06581 expressed protein Length = 284 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -2 Query: 150 IKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHE 37 +K LEA + +T+T++ L+ R + E LN E+H+ Sbjct: 133 LKKLEAEITETKTEVKMLKERESETEVALATLNAELHK 170 >At3g15600.1 68416.m01976 hypothetical protein low similarity to KED [Nicotiana tabacum] GI:8096269; contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 591 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = -2 Query: 189 RDFKLAIEDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHEIPESRNE 16 +DF E+++KR+K LEAA+ Q S +++ A K D E+ E ++ E Sbjct: 356 KDFSKKYEEQDKRLKLLEAAIKSIQ---SGIRTEDACGSKEIDDKENELEEGSDAETE 410 >At3g23980.1 68416.m03012 dentin sialophosphoprotein-related contains weak similarity to Dentin sialophosphoprotein precursor (Swiss-Prot:Q9NZW4) [Homo sapiens] Length = 736 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -2 Query: 177 LAIEDKEKRIKF----LEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHEIPESR 22 +++EDK R++ LE L K QT++ + + ++EK +DL I + E + Sbjct: 458 ISLEDKALRLRSNELKLERELEKAQTEMLSYKKKLQSLEKDRQDLQSTIKALQEEK 513 >At2g22560.1 68415.m02674 kinase interacting protein-related similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia]; weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum Length = 891 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -2 Query: 177 LAIEDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHEIPE 28 +AIED+E R E A+ Q L +LQ + + +R+ +++I E E Sbjct: 180 VAIEDEEARRLMTETAIKSCQEKLVELQEKQEKSYEEAREEHVKIKESKE 229 >At3g47400.1 68416.m05154 pectinesterase family protein similar to pectinesterase (EC 3.1.1.11) from Vitis vinifera GI:15081598, Lycopersicon esculentum SP|Q43143 SP|P14280; contains Pfam profile PF01095 pectinesterase Length = 594 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 117 QTDLSKLQSRTATIEKISRDLNIEIHEIPESRNENVLDL 1 QT LS Q+ T S DLN+ +P N+N+ DL Sbjct: 192 QTWLSTAQTNIETCRSGSEDLNVSDFVMPVISNKNLSDL 230 >At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature Length = 348 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 418 CIYLFTQL*FGHFLYITLFLSRVH 489 CI+ + + FG F+YI L ++R H Sbjct: 325 CIFFISSILFGLFVYIFLLINRKH 348 >At3g44740.1 68416.m04816 tRNA synthetase class II (G, H, P and S) family protein similar to SP|O23627 Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) {Arabidopsis thaliana}; contains Pfam profile PF00587: tRNA synthetase class II core domain (G, H, P, S and T) Length = 276 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -3 Query: 161 KKSVLSFWKQHFL 123 K +VLSFW+QHF+ Sbjct: 33 KSNVLSFWRQHFI 45 >At1g29880.1 68414.m03652 glycyl-tRNA synthetase / glycine--tRNA ligase identical to SP|O23627 Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) {Arabidopsis thaliana} Length = 729 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -3 Query: 161 KKSVLSFWKQHFL 123 K +VLSFW+QHF+ Sbjct: 154 KSNVLSFWRQHFI 166 >At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almost identical to CIP1 (GI:836950) [Arabidopsis thaliana] Length = 1305 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = -2 Query: 204 ITAEQRDFKLAIEDKEKRIKFLEAALLKTQTDLSKLQSRTATIE 73 +TA+ K + +KE ++ L K+Q + +L++ AT+E Sbjct: 715 LTADSSKLKEQLAEKESKLFLLTEKDSKSQVQIKELEATVATLE 758 >At4g17730.1 68417.m02647 syntaxin 23 (SYP23) / PEP12-like protein identical to SP|O04378 Syntaxin 23 (AtSYP23) (AtPLP) (AtPEP12-like protein) {Arabidopsis thaliana} Length = 255 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/56 (23%), Positives = 30/56 (53%) Frame = -2 Query: 204 ITAEQRDFKLAIEDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHE 37 + E + +L + D E I F EA + + + + ++Q + + +I +DL + +H+ Sbjct: 164 LLVESKRQELVLLDNE--IAFNEAVIEEREQGIQEIQQQIGEVHEIFKDLAVLVHD 217 >At2g45900.1 68415.m05708 expressed protein Length = 720 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/43 (25%), Positives = 26/43 (60%) Frame = -2 Query: 195 EQRDFKLAIEDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKI 67 + D K ++DKE +++++A + ++ + +L +R+ EKI Sbjct: 542 KDNDVKTRMDDKELALEYIQAVVKSSELNWEELLARSFYSEKI 584 >At1g44080.1 68414.m05088 F-box protein-related / C-type lectin-related contains F-box domain Pfam:PF00646, PF00059: Lectin C-type domain Length = 347 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 79 CSCATLQLGKVSLSFKKCCFQKLNTLFF 162 CS T Q+ S S + CFQ +T FF Sbjct: 320 CSIITKQINSSSSSSHQSCFQMFSTSFF 347 >At1g03990.1 68414.m00385 alcohol oxidase-related low similarity to long chain fatty alcohol oxidase from Candida cloacae [GI:6983581], Candida tropicalis [GI:6983594]; Location of EST 248L9T7, gb|AA713296 Length = 758 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +2 Query: 155 FSLSSIANLKSLCSAVMKSVVLKGLSYQV-IKSLKKYVLI 271 FS S + L S+C A+M V L+ L+ ++ +K L+ L+ Sbjct: 28 FSKSDLQALSSICDAIMPPVPLESLNLEMKLKVLRNDALL 67 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,720,692 Number of Sequences: 28952 Number of extensions: 154334 Number of successful extensions: 443 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -