BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30972.Seq (597 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1370 - 32990002-32990244,32990950-32991943,32992019-329922... 57 9e-09 10_08_0050 + 14469879-14470072,14470620-14471094 29 2.1 05_01_0029 + 187769-188707,188971-189246,189978-190174,190263-19... 29 2.8 04_04_1220 + 31843628-31844755 29 3.7 08_01_0844 - 8283858-8284409,8284883-8284963 28 4.9 12_02_0625 - 21331209-21331273,21331364-21331555,21332348-213325... 28 6.5 04_04_1359 - 32886181-32886789 28 6.5 01_06_0854 - 32477994-32478161,32478689-32478826,32479225-324794... 27 8.6 >04_04_1370 - 32990002-32990244,32990950-32991943,32992019-32992240, 32993413-32993543 Length = 529 Score = 57.2 bits (132), Expect = 9e-09 Identities = 31/61 (50%), Positives = 39/61 (63%), Gaps = 3/61 (4%) Frame = -1 Query: 561 AADCAPPEATLRRRRDGA---NSVLMQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRV 391 A + E R DG N++LMQ+QADLLG PV+RP +E+TALGAA AG A+ V Sbjct: 421 AGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGV 480 Query: 390 W 388 W Sbjct: 481 W 481 >10_08_0050 + 14469879-14470072,14470620-14471094 Length = 222 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 279 GWTDTKNELSTQKNQIELLQFCRRD 205 G+T T ++ S N E+L+FCRR+ Sbjct: 101 GFTSTSSDRSNSGNSSEMLRFCRRE 125 >05_01_0029 + 187769-188707,188971-189246,189978-190174,190263-190404, 190584-190862,190941-191013,191331-191379,192169-192433, 192576-192631,192777-192845,193028-193139,193682-193771, 193955-194125,194449-194506,194970-195128,195379-195401 Length = 985 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 351 GMYRPVGWVLSWATHALRDLRQWPPPGL 434 G PVGW L + T L D PPP L Sbjct: 926 GNNNPVGWPLRFLTPVLSDENSVPPPSL 953 >04_04_1220 + 31843628-31844755 Length = 375 Score = 28.7 bits (61), Expect = 3.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 427 GGGHCRRSRNACVAHDNTQPT 365 GGGH R R +CV D+ +P+ Sbjct: 231 GGGHMRERRTSCVVVDDMEPS 251 >08_01_0844 - 8283858-8284409,8284883-8284963 Length = 210 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 594 CHKTRALXDAMAADCAPPEATLRRRRDG 511 C +R+ A AA C PP+ RR R G Sbjct: 164 CGSSRSRDGASAAGCLPPDVGKRRHRGG 191 >12_02_0625 - 21331209-21331273,21331364-21331555,21332348-21332558, 21333600-21333700,21333839-21333844,21333956-21334051, 21334485-21334497 Length = 227 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -1 Query: 489 MQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPSPPAD 358 +QADLLG PVIRP + AG ++ PP D Sbjct: 41 LQADLLGSPVIRPSEPLELQKQLELAAGIWIKAVDPAFGLPPVD 84 >04_04_1359 - 32886181-32886789 Length = 202 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +3 Query: 423 PPGLYFPS*GDE*LVYPVNQPASASELSSRHPSVGEELPQGARSLQPSRPXRRASC 590 P LY+ + PV+ A ++S S LP + SL PS P +SC Sbjct: 89 PQPLYYSHHHHRLMHSPVSPMDYAYVMASSSSSSSSSLPSSSSSLSPSPPASSSSC 144 >01_06_0854 - 32477994-32478161,32478689-32478826,32479225-32479440, 32479580-32479656,32481144-32481555,32482248-32482850, 32482954-32483229 Length = 629 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 496 DADAG*FTGYTSHSSPHDGKYSPGGGHCRRSRNACVAHDNTQPTG 362 DAD G T HS P G+ G G RR R T P G Sbjct: 387 DADGGGGADSTGHSPPRSGR-KRGAGQQRRQRRRSPRPRVTAPDG 430 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,581,479 Number of Sequences: 37544 Number of extensions: 379963 Number of successful extensions: 1094 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1094 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -