BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30969.Seq (507 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29066| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 2e-27 SB_27203| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 5.1 >SB_29066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 119 bits (286), Expect = 2e-27 Identities = 51/58 (87%), Positives = 56/58 (96%) Frame = +2 Query: 254 QMVGSIVGIYNGKTFNQVEIKPEMIGHYLGEFSVTYKPVKHGRPGICATHSSRFIPLK 427 +M+GS+VG+YNGKTF QVEIKPEMIGHYLGEFS+TYKPVKHGRPGI ATHSSRFIPLK Sbjct: 92 EMIGSVVGVYNGKTFTQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 149 Score = 116 bits (279), Expect = 1e-26 Identities = 56/82 (68%), Positives = 66/82 (80%) Frame = +3 Query: 9 LKKKRIFRKFTYRGVDLDQLLDMPNEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKK 188 +K+KR FRKFTYRGVDLDQLLD+ +EQLMEL+ GLKRKP+AL+K+LR+AKK Sbjct: 10 IKRKRTFRKFTYRGVDLDQLLDLSHEQLMELVCCRQRRRFTRGLKRKPLALMKRLRKAKK 69 Query: 189 EAPPNEKPEIVKTXLRXMIIVP 254 EA P EKPE+VKT LR MIIVP Sbjct: 70 EAAPMEKPEVVKTHLRNMIIVP 91 >SB_27203| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 527 Score = 27.9 bits (59), Expect = 5.1 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +1 Query: 1 TKPSRKSVFSGSSLTGELISISSLICPMSNSWN*CMXVRAGGSLVVLNV 147 TKP S SGS+ G L SS C S+S + + V GG + V V Sbjct: 179 TKPDAMSASSGSASAGRLYGNSSW-CSTSSSVSEYLQVDLGGVMTVSGV 226 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,468,472 Number of Sequences: 59808 Number of extensions: 236704 Number of successful extensions: 427 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -