BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30965.Seq (349 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 86 9e-18 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 51 2e-07 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 5e-07 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 49 1e-06 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 47 5e-06 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 5e-06 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 44 3e-05 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 43 8e-05 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 42 1e-04 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 42 2e-04 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 42 2e-04 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 41 2e-04 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 41 2e-04 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 40 4e-04 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 40 6e-04 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.001 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 38 0.002 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.005 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 37 0.005 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 36 0.007 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.021 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 34 0.028 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 31 0.26 SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) 30 0.59 SB_24670| Best HMM Match : DivIC (HMM E-Value=2) 29 0.78 SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_19426| Best HMM Match : Calx-beta (HMM E-Value=3e-06) 27 3.2 SB_35037| Best HMM Match : Far-17a_AIG1 (HMM E-Value=4.6e-30) 27 3.2 SB_20428| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_17356| Best HMM Match : DUF590 (HMM E-Value=0) 27 3.2 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.2 SB_33085| Best HMM Match : Trypsin (HMM E-Value=0) 27 5.5 SB_51776| Best HMM Match : S-antigen (HMM E-Value=0.24) 26 9.7 SB_41168| Best HMM Match : Borrelia_orfA (HMM E-Value=0.77) 26 9.7 SB_36278| Best HMM Match : Homeobox (HMM E-Value=4.8e-30) 26 9.7 SB_15248| Best HMM Match : 7tm_1 (HMM E-Value=1.9e-21) 26 9.7 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 85.8 bits (203), Expect = 9e-18 Identities = 38/63 (60%), Positives = 49/63 (77%), Gaps = 2/63 (3%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKA--E 256 K + PKR MSAY+LWLN R +IKD NPG+ VTE++K AGE+W+++ DKS+WEEKA E Sbjct: 537 KDPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAAIE 596 Query: 257 KPK 265 K K Sbjct: 597 KQK 599 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 51.2 bits (117), Expect = 2e-07 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 4/71 (5%) Frame = +2 Query: 59 IKIHI*GFKMTDKP--KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYD- 229 + + + G K T KP KRPM+A+++W +AR K+ D P L E++K G++W+ + D Sbjct: 50 LPVRVNGIK-TQKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLNDS 108 Query: 230 -KSEWEEKAEK 259 K + E+AE+ Sbjct: 109 EKKPFIEEAER 119 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 50.0 bits (114), Expect = 5e-07 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAE 256 K +KPKR +SAY ++N R +K DNP ++K GE+W M DK+++++ A+ Sbjct: 97 KDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAK 156 Query: 257 KPK 265 K K Sbjct: 157 KDK 159 Score = 35.1 bits (77), Expect = 0.016 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAE 256 K +KPK SAY +L R K++ + + + +K + E W++M +K + +KA Sbjct: 7 KDPNKPKGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEKETFVQKAG 66 Query: 257 KPK 265 K K Sbjct: 67 KDK 69 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 48.8 bits (111), Expect = 1e-06 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAE 256 K + KRPM+A+++W R KI +NP + +EI+K+ G W+ + DK + E+A+ Sbjct: 322 KPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAK 381 Query: 257 K 259 K Sbjct: 382 K 382 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 48.8 bits (111), Expect = 1e-06 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAE 256 K + KRPM+A+++W R KI +NP + +EI+K+ G W+ + DK + E+A+ Sbjct: 5 KPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAK 64 Query: 257 K 259 K Sbjct: 65 K 65 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 46.8 bits (106), Expect = 5e-06 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAEK 259 KRPM+++++W R K ++NP L EI+K G+ W + DK + EKAE+ Sbjct: 95 KRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAER 149 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 46.8 bits (106), Expect = 5e-06 Identities = 17/49 (34%), Positives = 32/49 (65%) Frame = +2 Query: 92 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 238 D+ KRPM+A+++W R K+ DNP + +EI+K+ G W+ + ++ + Sbjct: 787 DRVKRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLLSEQEK 835 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 45.6 bits (103), Expect = 1e-05 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAE 256 K K KRPM+++++W SAR K+ + P + E++K G++WR S +K + ++A Sbjct: 106 KKDPKVKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRMLSAAEKQPYVDEAA 165 Query: 257 K 259 + Sbjct: 166 R 166 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 44.8 bits (101), Expect = 2e-05 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = +2 Query: 89 TDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAEK 259 T++ KRPM+A+++W R ++ D NP L E++K G WR++ K + ++AE+ Sbjct: 363 TERIKRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRALNSTQKRPFVDEAER 421 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 44.4 bits (100), Expect = 3e-05 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAE 256 K + PK P++ Y+ +LN R K++ +NP L E+ + G +W + K + E+AE Sbjct: 172 KDVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAE 231 Query: 257 KPK 265 K K Sbjct: 232 KDK 234 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 5e-05 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAE 256 K D KRPM+AY++W R +I ++ P + +EI+K+ G W S+ +K + E+A+ Sbjct: 3 KPGDHIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSLTLDEKQPYVEEAK 62 Query: 257 K 259 + Sbjct: 63 R 63 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 42.7 bits (96), Expect = 8e-05 Identities = 20/61 (32%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = +2 Query: 89 TDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAEKP 262 ++K KRP++A++LW R I ++NP + +I++K G W+ + +K+ + E+A+K Sbjct: 16 SEKIKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEEEKAYYFEEAKKL 75 Query: 263 K 265 K Sbjct: 76 K 76 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 42.3 bits (95), Expect = 1e-04 Identities = 18/55 (32%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAEK 259 KRPM+A+++W R K+ +++P + EI+K+ G+ W+ S +K + E++E+ Sbjct: 46 KRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSESEKRPFVEESER 100 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 42.3 bits (95), Expect = 1e-04 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAE 256 KRPM+ +++W R +I +NPG+ ++K G W+ S+ +K + EKA+ Sbjct: 9 KRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKLSVEEKEPYIEKAK 62 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 41.9 bits (94), Expect = 1e-04 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = +2 Query: 92 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYD--KSEWEEKAEKPK 265 ++PK P+++Y + R+K+ P LK TE+A K + WR M + K + E+ E+ K Sbjct: 150 NQPKMPLTSYFRYCQKHRAKLAKKYPNLKSTELAAKLSKKWRKMSEERKKAYTEQYEEEK 209 Score = 37.5 bits (83), Expect = 0.003 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +2 Query: 107 PMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE--W--EEKAEKPK 265 P+SA+ LW N AR + NP + ++ KK W+ + +K + W +EK E K Sbjct: 230 PLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEKGKKTWIKKEKTEMRK 286 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 41.5 bits (93), Expect = 2e-04 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 5/63 (7%) Frame = +2 Query: 92 DKPKRPMSAYLLW---LNSARSKIKDDNPGLKVTEIAKKAGEIWRSMY--DKSEWEEKAE 256 +KPK P++ Y+ + LNS R +K +P L EI K G+ W S+ +K ++ ++AE Sbjct: 192 NKPKAPVTGYVHYVRFLNSRRESVKHQHPHLTFPEITKMLGQEWNSLLPEEKQKFLDEAE 251 Query: 257 KPK 265 + K Sbjct: 252 EDK 254 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 41.5 bits (93), Expect = 2e-04 Identities = 20/64 (31%), Positives = 36/64 (56%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAEKPKNNTL* 280 KRPM+A+++W + R ++ +NP L ++I+K G WR + + + + AE N L Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKLTVEEKQKFFAEAKLLNELH 67 Query: 281 I*NH 292 + H Sbjct: 68 MIEH 71 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 41.5 bits (93), Expect = 2e-04 Identities = 20/64 (31%), Positives = 36/64 (56%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAEKPKNNTL* 280 KRPM+A+++W + R ++ +NP L ++I+K G WR + + + + AE N L Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKLTVEEKQKFFAEAKLLNELH 67 Query: 281 I*NH 292 + H Sbjct: 68 MIEH 71 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 41.1 bits (92), Expect = 2e-04 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +2 Query: 92 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 223 D KRP++++++W R + +NP ++ EI+K G+ WR M Sbjct: 8 DHVKRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKM 51 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 41.1 bits (92), Expect = 2e-04 Identities = 16/56 (28%), Positives = 31/56 (55%) Frame = +2 Query: 98 PKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAEKPK 265 P++P+ Y+ + ++K+ NP K+ +I K G++WR + D + +E E K Sbjct: 28 PEKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDDAEKQQEYNEAVK 83 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 40.3 bits (90), Expect = 4e-04 Identities = 15/52 (28%), Positives = 32/52 (61%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 238 K+ +P +P+SAY ++ ++ I+ NP + EIAK G++W ++ ++ + Sbjct: 920 KIEGEPPKPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEEQK 971 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 39.9 bits (89), Expect = 6e-04 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +2 Query: 92 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM--YDKSEWEEKAE 256 D+ + + + LWL R +I+++NP + ++ K A + W+ + +K W EKA+ Sbjct: 327 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEKKVWNEKAK 383 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 39.1 bits (87), Expect = 0.001 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +2 Query: 95 KPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 238 K KRPM+A+++W RS I P EI+ + GEIW + + + Sbjct: 100 KVKRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQQ 147 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 37.9 bits (84), Expect = 0.002 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAE 256 KR S YLL+ + R I+ ++P EI++ GE WR S K+E+E KA+ Sbjct: 36 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENKAQ 89 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 37.9 bits (84), Expect = 0.002 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWR--SMYDKSEWEEKAE 256 KR S YLL+ + R I+ ++P EI++ GE WR S K+E+E KA+ Sbjct: 1269 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRNASAARKAEYENKAQ 1322 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 36.7 bits (81), Expect = 0.005 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYD--KSEWEEKAEK 259 KRPM+A+++W R + P + +EI+K G W++M D K + EKA++ Sbjct: 10 KRPMNAFMVWSKERRRIKSQECPRMHNSEISKILGCEWKAMKDELKQPYIEKAKE 64 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 36.7 bits (81), Expect = 0.005 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = +2 Query: 83 KMTDKPKRPMSAYLLWLNSARSKI--KDDNPGLKVTEIAKKAGEIWRSMYDKSE 238 K DKPKRP +AY L+L + R ++ K G K+ + AGE WR M D+ + Sbjct: 572 KDPDKPKRPPTAYFLFLAAFRKEMAGKALEDGKKIPSL---AGERWREMSDEDK 622 Score = 35.9 bits (79), Expect = 0.009 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 7/66 (10%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIK-----DDNPGLKVTEIAKKAGEIWRSMYD--KSEWEEKAEK 259 KR SAY+ + + R+K+K P K E+AK AGE W+ + D K + KAE Sbjct: 497 KRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQKKPYVAKAEA 556 Query: 260 PKNNTL 277 K L Sbjct: 557 DKQRYL 562 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 36.3 bits (80), Expect = 0.007 Identities = 17/62 (27%), Positives = 34/62 (54%) Frame = +2 Query: 92 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAEKPKNN 271 D+ + + + LWL R +I+++NP + ++ K A + W+ + E+K EK ++ Sbjct: 34 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGL---DSVEKKLEKCYDD 90 Query: 272 TL 277 TL Sbjct: 91 TL 92 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 34.7 bits (76), Expect = 0.021 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 95 KPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 223 K KRP A+ + K+K++NP LK EI K + W ++ Sbjct: 305 KHKRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANL 347 Score = 32.7 bits (71), Expect = 0.084 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = +2 Query: 98 PKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAEKPKN 268 P++P + L++ +KIK +N G+ +I ++ G WR++ SE EE K ++ Sbjct: 374 PRKPPRHFSLFMRENFAKIKAENQGMSNPDIMRELGAKWRNL-PFSEREEIRRKSED 429 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 34.3 bits (75), Expect = 0.028 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSE 238 KRPM+A+++W + R K+ P + EI+K G W + ++ + Sbjct: 10 KRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEEEK 55 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 31.1 bits (67), Expect = 0.26 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +2 Query: 101 KRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAEKPK 265 K PM+A+++ R NPG+ +E +K G W+ M E + +PK Sbjct: 10 KSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWK-MLTSEEKDPFIAEPK 63 >SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) Length = 332 Score = 29.9 bits (64), Expect = 0.59 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 152 IKDDNPGL-KVTEIAKKAGEIWRSMYDKSEWEEKAEK 259 IK D L K TE AKKA E W+ + + W+E+ E+ Sbjct: 232 IKKDLKKLPKTTEEAKKAEERWQRLKTELNWDERYEE 268 >SB_24670| Best HMM Match : DivIC (HMM E-Value=2) Length = 152 Score = 29.5 bits (63), Expect = 0.78 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +2 Query: 116 AYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSMYDKSEWEEKAEK 259 AY +W ++ ++ K +K TE+A K ++ ++ + EWE+K EK Sbjct: 9 AYSVWQHAQQTLTKKREALVK-TELAGKNEKLPQAQEEVKEWEQKVEK 55 >SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3066 Score = 28.7 bits (61), Expect = 1.4 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 Query: 203 GEIWRSMYDKSEWEEKAEKPK 265 GE W M+DKS E+ EKPK Sbjct: 71 GETWPQMHDKSGTIERFEKPK 91 >SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 27.5 bits (58), Expect = 3.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 170 GLKVTEIAKKAGEIWRSMYDKSEWEEKAEKPKNNTL 277 G K ++ K+AG + D + EE+ E+ K+N L Sbjct: 741 GRKARKVTKRAGTAFVGSIDNDDEEEEEEQEKSNDL 776 >SB_19426| Best HMM Match : Calx-beta (HMM E-Value=3e-06) Length = 631 Score = 27.5 bits (58), Expect = 3.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 186 SVTFNPGLSSFIFDLALFNH 127 SVTFNPG SS +F + + N+ Sbjct: 525 SVTFNPGQSSVVFTIDIANN 544 >SB_35037| Best HMM Match : Far-17a_AIG1 (HMM E-Value=4.6e-30) Length = 227 Score = 27.5 bits (58), Expect = 3.2 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -2 Query: 270 LFFGFSAFSSHSLLSYMDLQISPAFLAISVTFNPGLSSFIFDLALFNH 127 LF+G H++ S DL+ P +L + PGL S I + LF H Sbjct: 98 LFWGLCIIDPHAIQSKEDLEQIPLWLNHYMHSFPGL-SVILETFLFKH 144 >SB_20428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 27.5 bits (58), Expect = 3.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 348 PAFLGFLFFLYGTAAI 301 P+FLG L FLYG A I Sbjct: 108 PSFLGLLVFLYGVATI 123 >SB_17356| Best HMM Match : DUF590 (HMM E-Value=0) Length = 982 Score = 27.5 bits (58), Expect = 3.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 348 PAFLGFLFFLYGTAAI 301 P+FLG L FLYG A I Sbjct: 443 PSFLGLLVFLYGVATI 458 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 27.1 bits (57), Expect = 4.2 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +2 Query: 92 DKPKRPMSAYLLWLNSARSKIKDDNPGLKVTEIAKKAGEIWRSM 223 D +RPM+A++++ R+ + +P ++K GE W ++ Sbjct: 514 DHIRRPMNAFMIFSKRHRALVHQKHPHQDNRTVSKILGEWWYAL 557 >SB_33085| Best HMM Match : Trypsin (HMM E-Value=0) Length = 537 Score = 26.6 bits (56), Expect = 5.5 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 320 STGPP-PFALNDSKSTMYCSLAFPP 249 +TG P P AL ++++T+YCS P Sbjct: 274 TTGKPNPVALGNARATLYCSATAEP 298 >SB_51776| Best HMM Match : S-antigen (HMM E-Value=0.24) Length = 1669 Score = 25.8 bits (54), Expect = 9.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 241 GRKGGKAKEQYIVDLESFNANGGGPVEKKKKTQKR 345 G GG ++E D+ + N NG +K+KT+KR Sbjct: 985 GGSGGSSQEDTETDVSNVNGNG-----RKRKTRKR 1014 >SB_41168| Best HMM Match : Borrelia_orfA (HMM E-Value=0.77) Length = 738 Score = 25.8 bits (54), Expect = 9.7 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +1 Query: 199 SRRNLEVHV*QKRMGRKGGKAKEQYIVDLESFNANGGGPVEKKKKTQKR 345 +R N + + RM RK GKA+ QY + + + +K KT KR Sbjct: 298 NRLNKRMRIYINRMRRKHGKARRQYNIRVRILRRQ--ITILRKNKTAKR 344 >SB_36278| Best HMM Match : Homeobox (HMM E-Value=4.8e-30) Length = 166 Score = 25.8 bits (54), Expect = 9.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 125 LWLNSARSKIKDDNPGLKVT 184 +W + R+K K NPG+ VT Sbjct: 94 IWFQNRRTKWKKQNPGMDVT 113 >SB_15248| Best HMM Match : 7tm_1 (HMM E-Value=1.9e-21) Length = 325 Score = 25.8 bits (54), Expect = 9.7 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = -2 Query: 279 YNVLFFGFSAFSSHSLLSYMDLQISPAFLAISVTFNPGLSSFIF 148 YNVL+ S L++ + L I + ++ F+P L++F++ Sbjct: 260 YNVLYLYLQFASRPPLVTVIKLGIISRAVTVTSYFHPALNAFLY 303 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,948,981 Number of Sequences: 59808 Number of extensions: 202329 Number of successful extensions: 684 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 523129866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -