BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30963.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) 107 8e-24 SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 1e-15 SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0) 78 4e-15 SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0) 64 7e-11 SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06) 63 2e-10 SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0) 62 3e-10 SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) 62 4e-10 SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33) 58 6e-09 SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) 55 3e-08 SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21) 42 3e-04 SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) 37 0.012 SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19) 36 0.017 SB_31331| Best HMM Match : Thioredoxin (HMM E-Value=1.2) 35 0.038 SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) 35 0.038 SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) 34 0.067 SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07) 33 0.20 SB_59094| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_2701| Best HMM Match : Thioredoxin (HMM E-Value=4.8e-05) 31 0.82 SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) 29 1.9 SB_25332| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_8819| Best HMM Match : I-set (HMM E-Value=0) 29 3.3 SB_45044| Best HMM Match : Thioredoxin (HMM E-Value=1.1) 28 5.8 SB_25578| Best HMM Match : ShTK (HMM E-Value=2.4e-06) 28 5.8 SB_13271| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_40719| Best HMM Match : CUB (HMM E-Value=1.2e-07) 28 5.8 SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) 27 7.6 SB_35488| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) 27 7.6 SB_25427| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_23867| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_19767| Best HMM Match : ADK (HMM E-Value=0.26) 27 7.6 >SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 536 Score = 107 bits (256), Expect = 8e-24 Identities = 50/97 (51%), Positives = 66/97 (68%) Frame = +1 Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPP 432 +S IKLAKVDAT E L E + V+GYPT+KFF++G P +Y+GGR A +I+SWL KKTGPP Sbjct: 74 KSEIKLAKVDATAETKLGEKFQVQGYPTIKFFKDGKPSEYAGGRTAPEIVSWLNKKTGPP 133 Query: 433 AVEVTSAEQAKELIDANXVIVFGFFWTRAQPEPKTFL 543 A ++ +A+ K+ I V V GFF + K FL Sbjct: 134 AKDLATADAMKDFI-TKEVAVVGFFTDKESDAAKAFL 169 Score = 90.2 bits (214), Expect = 1e-18 Identities = 38/73 (52%), Positives = 54/73 (73%) Frame = +2 Query: 35 MRVLIFTAIALLGLALGDEVPTEENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLA 214 M++L +AL+ LA +E+ EE+VL L++ NF+ + +++LVEFYAPWCGHCK+LA Sbjct: 1 MKLLPVLLLALVSLAYSEEIKEEEDVLVLTEKNFDEAVAANKHVLVEFYAPWCGHCKALA 60 Query: 215 PEYAKAATKLAEE 253 PEYAKAA +L E Sbjct: 61 PEYAKAAGQLKSE 73 Score = 48.4 bits (110), Expect = 4e-06 Identities = 28/78 (35%), Positives = 40/78 (51%), Gaps = 4/78 (5%) Frame = +2 Query: 20 ADNIEMRVLIFTAIALLGLALGDEVPTE---ENVLXLSKANFETVITTTEY-ILVEFYAP 187 ++N++ V F L L E+P + + V L NF+ V + + VEFYAP Sbjct: 353 SENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKVLCGKNFDEVARNKDKNVFVEFYAP 412 Query: 188 WCGHCKSLAPEYAKAATK 241 WCGHCK LAP + + K Sbjct: 413 WCGHCKQLAPIWDQLGEK 430 Score = 44.8 bits (101), Expect = 5e-05 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 4/64 (6%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF-RNGSPIDYSGGRQADDIISWLK---KKTGP 429 I +AK+D+T + E V +PT+K+F + G +DY+GGR DD + +L+ K Sbjct: 437 IVVAKMDSTANE--VEGVKVHSFPTIKYFPKEGEAVDYNGGRTLDDFVKFLESGGKAGNE 494 Query: 430 PAVE 441 PA E Sbjct: 495 PAAE 498 >SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 80.2 bits (189), Expect = 1e-15 Identities = 36/57 (63%), Positives = 41/57 (71%) Frame = +2 Query: 86 DEVPTEENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 DEV E++V L+ NF+ VI ILVEFYAPWCGHCKSLAPEYAKAA K+ D Sbjct: 55 DEVKEEDDVSVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLND 111 Score = 69.7 bits (163), Expect = 1e-12 Identities = 34/84 (40%), Positives = 52/84 (61%), Gaps = 1/84 (1%) Frame = +1 Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 438 PI LA VDAT E +LA+ Y V+GYPTLK FR G +Y G R I S+++ + GP + Sbjct: 228 PIPLAIVDATIESELAQKYEVQGYPTLKVFRKGKATEYKGQRDQYGIASYMRSQVGPSSR 287 Query: 439 EVTSAEQAKELI-DANXVIVFGFF 507 ++S + ++ + + + V + GFF Sbjct: 288 ILSSLKAVQDFMKEKDDVTIMGFF 311 Score = 67.7 bits (158), Expect = 6e-12 Identities = 32/89 (35%), Positives = 53/89 (59%), Gaps = 6/89 (6%) Frame = +1 Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG---- 426 P+ AK+DAT D+A+ + V GYPTLK FR G+P +Y G R+ I+ ++KK++ Sbjct: 113 PVPFAKMDATVASDIAQRFDVSGYPTLKIFRKGTPYEYEGPREESGIVEYMKKQSDPNWK 172 Query: 427 -PPAVEVT-SAEQAKELIDANXVIVFGFF 507 PP +T + E E+++ +++ FF Sbjct: 173 PPPVAALTLTKENFTEVVNRESLMLVEFF 201 Score = 67.7 bits (158), Expect = 6e-12 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = +2 Query: 95 PTEENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 P L L+K NF V+ +LVEF+APWCGHCK LAPEY KAA +L + D Sbjct: 173 PPPVAALTLTKENFTEVVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKHD 226 Score = 44.0 bits (99), Expect = 8e-05 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 3/72 (4%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTGPP 432 I +AK+DAT D+ +Y V G+PT+ F + +PI + GGR+ D+I ++++K Sbjct: 576 IVIAKIDATAN-DVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEK---- 630 Query: 433 AVEVTSAEQAKE 468 A S E+AK+ Sbjct: 631 ATVSLSKEKAKD 642 Score = 31.5 bits (68), Expect = 0.47 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 3/72 (4%) Frame = +2 Query: 23 DNIEMRVLIFTAIALLGLALGDEVP--TEENVLXLSKANFETVITTTEY-ILVEFYAPWC 193 D++ V F A L + VP +E V + F+ ++ + +L+EFYAPWC Sbjct: 496 DSLREFVEEFKAGNLKPIIKSQPVPKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWC 555 Query: 194 GHCKSLAPEYAK 229 G +L P + K Sbjct: 556 G--IALEPTFKK 565 >SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 1056 Score = 78.2 bits (184), Expect = 4e-15 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 3/85 (3%) Frame = +1 Query: 259 PIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPP 432 P+ LAKVD T+ +D YGV GYPTLK FRNG DY G R + II ++KK+ GP Sbjct: 590 PVPLAKVDCTEAGKDTCSKYGVSGYPTLKIFRNGEMSKDYDGPRDSSGIIRYMKKQAGPS 649 Query: 433 AVEVTSAEQ-AKELIDANXVIVFGF 504 +VE+ S + K+L DA +V GF Sbjct: 650 SVEIKSVDHLEKKLDDAESNVVVGF 674 Score = 62.9 bits (146), Expect = 2e-10 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = +2 Query: 107 NVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 +VL L +NF++ + + +LVEF+APWCGHCK LAPEY AA L + D Sbjct: 539 DVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKND 588 Score = 55.2 bits (127), Expect = 3e-08 Identities = 28/87 (32%), Positives = 51/87 (58%), Gaps = 2/87 (2%) Frame = +2 Query: 131 NFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAE-EDLLSN*RKLTQLKNRIS 304 NF+ ++ T+ +L+EFYAPWCGHCKSL P+Y + KL + +D++ K+ N Sbjct: 871 NFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIVI--AKMDATANDAP 928 Query: 305 PRATVYEDTRLSNSSGMAVLSTIQVVV 385 P +V + + + G+ ++ I +++ Sbjct: 929 PNFSV-QGIIIISIIGIIIIVIIMIII 954 Score = 31.9 bits (69), Expect = 0.36 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 313 YGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 426 +G+ +PTLK FR G P DY+G + + S++ + G Sbjct: 448 FGIHQWPTLKLFRYGQPWGDYTGPQDTASLESYIHDQLG 486 >SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 362 Score = 64.1 bits (149), Expect = 7e-11 Identities = 28/49 (57%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +2 Query: 101 EENVLXLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244 +E+V+ L+ NFE V+ + + LVEF+APWCGHC+ LAPE+AKAAT+L Sbjct: 78 KEDVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAATEL 126 Score = 49.6 bits (113), Expect = 2e-06 Identities = 32/94 (34%), Positives = 44/94 (46%), Gaps = 10/94 (10%) Frame = +1 Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-----SPIDYSGGRQADDIISWLKK 417 + +K+ +DAT A Y V+GYPT+K F G S DY GGR A DII + Sbjct: 127 KGKVKVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDYQGGRTASDIIQYALD 186 Query: 418 KTG-----PPAVEVTSAEQAKELIDANXVIVFGF 504 K P ++ S E KE + + + V F Sbjct: 187 KAADSIEPPEVIQAISNEVLKEGCNEHPICVIAF 220 Score = 35.9 bits (79), Expect = 0.022 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 295 QDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 402 Q + Y +RG+PT+K F SP DY+G R A I+ Sbjct: 5 QSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQGIV 42 >SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06) Length = 70 Score = 62.9 bits (146), Expect = 2e-10 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = +2 Query: 107 NVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 +VL L +NF++ + + +LVEF+APWCGHCK LAPEY AA L + D Sbjct: 14 DVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKND 63 >SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 295 Score = 62.1 bits (144), Expect = 3e-10 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +2 Query: 98 TEENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223 T+ V+ L+K NF+ V+ ++ LVEFYAPWCGHCK LAP Y Sbjct: 20 TQGKVIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTY 61 Score = 60.1 bits (139), Expect = 1e-09 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 2/59 (3%) Frame = +1 Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426 S + +AKVDA ++DL + V+G+PT+K+F GS P +Y+GGR +D I ++++KTG Sbjct: 72 SDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEKTG 130 >SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) Length = 472 Score = 61.7 bits (143), Expect = 4e-10 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +2 Query: 74 LALGDEVPTEE-NVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244 L D VP +E +L L +NFE + +++LV+FYAPWC HCK +AP+Y A +L Sbjct: 123 LMASDGVPDDEPTLLELDDSNFEPAVQKHKFVLVDFYAPWCFHCKKMAPDYKDVAKEL 180 Score = 55.2 bits (127), Expect = 3e-08 Identities = 23/54 (42%), Positives = 32/54 (59%) Frame = +2 Query: 95 PTEENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 P VL L+ NF I EY+LV+FYAPWC C+ L+P + AA +L + + Sbjct: 48 PASPAVLNLNDQNFNETIKKNEYVLVDFYAPWCSDCQRLSPLFDTAALQLRDNN 101 >SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33) Length = 386 Score = 57.6 bits (133), Expect = 6e-09 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Frame = +2 Query: 86 DEVP---TEENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 DE P T V+ L F+ + +LV FYAPWCGHCK++ PEY AA L E++ Sbjct: 73 DEKPWSDTPSEVVHLRDDMFDDFVAKNPSVLVMFYAPWCGHCKAMKPEYVDAAQTLKEQE 132 Query: 257 L 259 + Sbjct: 133 I 133 Score = 54.0 bits (124), Expect = 8e-08 Identities = 23/49 (46%), Positives = 31/49 (63%) Frame = +2 Query: 89 EVPTEENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235 E+P+E V LS F++ + +++LV FYAPWCGHCK PE AA Sbjct: 192 EIPSE--VYHLSDTTFKSFVKKKKHVLVMFYAPWCGHCKKAKPELMSAA 238 Score = 38.3 bits (85), Expect = 0.004 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +1 Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWL-KKKTG 426 RR I A VD T+E + + +GV GY F + Y+ GR+A D I ++ + G Sbjct: 264 RRRLIAYAAVDCTKEMAVCQQFGVEGY----FNYGKNDFKYTSGREAKDFIQFMDDPREG 319 Query: 427 PP 432 PP Sbjct: 320 PP 321 Score = 33.1 bits (72), Expect = 0.15 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253 +++ Y CG+CK PE+A AAT+ +E Sbjct: 2 VVIVLYIAGCGYCKRFKPEFAAAATEHKDE 31 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 259 PIKLAKVDATQEQDLAESYGVRGYPT 336 P LA VDAT+E L + + V GYPT Sbjct: 134 PGVLAAVDATKEAALGKRFKVEGYPT 159 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +2 Query: 107 NVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241 NV L++ F+ + T + ILV FYAP C K A +Y +A K Sbjct: 335 NVQHLTQDTFDEALKTFDSILVMFYAP-CMKGK-FAFDYERARAK 377 >SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41) Length = 271 Score = 55.2 bits (127), Expect = 3e-08 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = +2 Query: 110 VLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253 V L ++F + TE++LV FYAPWCGHCK+ P+Y KAA ++ Sbjct: 149 VKQLDGSDFWGYLNNTEHVLVMFYAPWCGHCKNAKPKYEKAAETFKDQ 196 Score = 54.0 bits (124), Expect = 8e-08 Identities = 24/66 (36%), Positives = 35/66 (53%) Frame = +2 Query: 71 GLALGDEVPTEENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250 G D + V+ L+ + + I + E +LV ++APWCGHC + P Y KAA L + Sbjct: 39 GYPTSDWSKDDSKVVFLTDESHDEFIKSHENVLVMYFAPWCGHCNEMKPNYYKAAQVLHD 98 Query: 251 EDLLSN 268 ED N Sbjct: 99 EDANCN 104 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = +1 Query: 271 AKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGP 429 AK+D T+ D+ + V GYPTL+++ G ++Y G R +D+IS++++ P Sbjct: 202 AKLDCTKFGDVCDKEEVNGYPTLRYYLYGKFVVEYDGDRVTEDLISFMEEPPLP 255 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +1 Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWL 411 LA VD T+ +D+A+ + GYPT+K ++ + + + ++ L Sbjct: 105 LAAVDCTKHKDVAKKVALAGYPTVKLYKASNTAKAASAEEDSSLVKQL 152 >SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 488 Score = 54.0 bits (124), Expect = 8e-08 Identities = 22/51 (43%), Positives = 32/51 (62%) Frame = +2 Query: 101 EENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253 E + L+ +F+ + E +LV+FYAPWC C +L P+Y KAA LA+E Sbjct: 21 ENPIFELTDQDFDNFLKDKEVMLVDFYAPWCSDCDNLRPKYEKAARDLAKE 71 >SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 51.6 bits (118), Expect = 4e-07 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +2 Query: 110 VLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259 V L+ NF+ +I + +LV+FYAPWC HC+ L P+ AA LA + L Sbjct: 22 VYDLNAQNFDQMIREKDIMLVDFYAPWCHHCQELLPQLEGAANALAAKGL 71 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 43.2 bits (97), Expect = 1e-04 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 122 SKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244 SK F V+ + + +V+FYAPWCG C AP+Y + A L Sbjct: 440 SKNFFTDVLASEDAWVVDFYAPWCGPCMRFAPKYEQLAKML 480 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +2 Query: 74 LALGDEVPTEENVLXLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAA 235 +AL + NV L +F + +T+ + V+F+APWC C L PEY KAA Sbjct: 274 IALFAKESVSSNVHALGPEDFPSSVTSPSRPFFVDFFAPWCPPCMRLLPEYRKAA 328 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +1 Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLK 414 P+ VD T L Y +R YPT + N P + G A DII +++ Sbjct: 335 PVGFGTVDCTVHSQLCHQYNIRSYPTTILYNNSQPHQFIGHHNALDIIEFVE 386 >SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21) Length = 186 Score = 41.9 bits (94), Expect = 3e-04 Identities = 18/52 (34%), Positives = 31/52 (59%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417 + +AKVD T + +L +R YPT+K + +G Y+G R A+D+ ++ K Sbjct: 19 LTIAKVDCTSDVNLCVKQNIRAYPTMKLYYDGDIKRYTGRRNAEDMKVFVDK 70 Score = 37.1 bits (82), Expect = 0.009 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +2 Query: 98 TEENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235 +E V L+K F+ I + V+FYAPWC HC LAP + + A Sbjct: 88 SEAGVHILTKNTFDKHIELGLHF-VKFYAPWCIHCIKLAPIWERLA 132 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 319 VRGYPTLKFFRNG-SPIDYSGGRQADDIISWL 411 + GYPTL F++G +YSG R D + ++ Sbjct: 146 INGYPTLMLFKDGVQKKEYSGNRDLDSLYRFI 177 >SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 41.1 bits (92), Expect = 6e-04 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = +2 Query: 125 KANFETVITTTE--YILVEFYAPWCGHCKSLAPEYAKAA 235 +A F +VI T+ ++++FYA WCG C+ + P++ K A Sbjct: 18 RAEFNSVINNTKDKLVVIDFYAEWCGPCRQIKPKFKKMA 56 >SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) Length = 308 Score = 36.7 bits (81), Expect = 0.012 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 155 TEYILVEFYAPWCGHCKSLAPEYAKAATK 241 T+ ++ +F A WCG CKS+AP Y+ + K Sbjct: 27 TKLVVADFTASWCGPCKSIAPVYSGLSEK 55 Score = 32.3 bits (70), Expect = 0.27 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +1 Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426 K+D Q+LA GV PT +FF+N +D G + +KK G Sbjct: 63 KIDVDVCQELAAKQGVTAMPTFQFFKNKVKVDEVRGADPKALEDAIKKWIG 113 >SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19) Length = 335 Score = 36.3 bits (80), Expect = 0.017 Identities = 11/51 (21%), Positives = 28/51 (54%) Frame = +2 Query: 104 ENVLXLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256 + ++ + N + + ++++ + FYAPW HC+ + + + A + A+ D Sbjct: 26 KKIVEFTNENVDEYVDGSKFVFIFFYAPWDDHCQRILQIFDQVADEFADRD 76 >SB_31331| Best HMM Match : Thioredoxin (HMM E-Value=1.2) Length = 214 Score = 35.1 bits (77), Expect = 0.038 Identities = 20/82 (24%), Positives = 38/82 (46%) Frame = +1 Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441 + +A V+ +E +LA+ GV+ + F G ++Y G + + + + PP Sbjct: 104 VTVAAVNVAEEYELAQKLGVKFSGAISVFHRGKRVEYY-GHSCNLTNNVVFQMFDPPVTN 162 Query: 442 VTSAEQAKELIDANXVIVFGFF 507 + + +Q L DA V G+F Sbjct: 163 IDNKKQRTLLEDAEGTKVVGYF 184 >SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) Length = 456 Score = 35.1 bits (77), Expect = 0.038 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAE 250 ++++F A WCG CKS+AP + + K + Sbjct: 31 VVIDFTATWCGPCKSIAPVFTNLSMKFMD 59 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +1 Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID 369 KVD Q Q AES G+R PT F+ N + ID Sbjct: 64 KVDVDQCQLTAESCGIRAMPTFHFYHNKAKID 95 >SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19) Length = 975 Score = 34.3 bits (75), Expect = 0.067 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAP 217 + VI + +L+ FY PWCG C + AP Sbjct: 529 DIVINNDQDVLLVFYTPWCGMCINFAP 555 >SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07) Length = 438 Score = 32.7 bits (71), Expect = 0.20 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = +2 Query: 134 FETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA-----TKLAEEDLLSN*RKLTQLKNR 298 F+ + E ++F A WCG C+ + P++ + A K A+ D+ N ++ ++ NR Sbjct: 4 FDKFLKDNEVAAIDFTATWCGPCRMIGPKFEEMAKEFKGVKCAKVDVDVNSVEVLRVDNR 63 >SB_59094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 31.9 bits (69), Expect = 0.36 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 313 YGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 426 +G+ +PTLK FR G P DY+G + + S++ + G Sbjct: 251 FGIHQWPTLKLFRYGQPWGDYTGPQDTASLESYIHDQLG 289 >SB_2701| Best HMM Match : Thioredoxin (HMM E-Value=4.8e-05) Length = 215 Score = 30.7 bits (66), Expect = 0.82 Identities = 13/64 (20%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +2 Query: 131 NFETVITTTEYIL--VEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN*RKLTQLKNRIS 304 +F+ +++++ +L V F+APW HC + + A + + + N + + ++ + Sbjct: 11 DFDRILSSSSNVLAVVHFFAPWAPHCNQMNDVLEELAKENPHVNFIKNQKVVDRIDGANA 70 Query: 305 PRAT 316 P T Sbjct: 71 PELT 74 >SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) Length = 664 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 170 VEFYAPWCGHCKSLAPEYAKAATKL 244 V FYAPWCG + E+ AA+ L Sbjct: 457 VFFYAPWCGQSRRAVEEFNIAASLL 481 >SB_25332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 319 VRGYPTLKFFRNG-SPIDYSGGRQADDIISWL 411 + GYPTL F++G +YSG R D + ++ Sbjct: 1 INGYPTLMLFKDGVQKKEYSGNRDLDSLYRFI 32 >SB_8819| Best HMM Match : I-set (HMM E-Value=0) Length = 1789 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 265 KLAKVDATQEQDLAESYGVRGYP--TLKFFRNGSPI 366 KL V T+E D + V G P T+K+F++G P+ Sbjct: 1042 KLQPVQVTEEDDCKLTCKVSGLPEPTIKWFKDGEPV 1077 >SB_45044| Best HMM Match : Thioredoxin (HMM E-Value=1.1) Length = 213 Score = 27.9 bits (59), Expect = 5.8 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +2 Query: 188 WCGHCKSLAPEYAKA 232 WCG CK+L P++A++ Sbjct: 8 WCGACKALRPKFAES 22 >SB_25578| Best HMM Match : ShTK (HMM E-Value=2.4e-06) Length = 257 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 158 EYILVEFYAPWCGHCKSLAPEYAKAAT 238 +YI+ +F CG CK+LAP ++ T Sbjct: 123 KYIMKKFCQKECGLCKALAPPICQSTT 149 >SB_13271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 107 NVLXLSKANFETVITTTEYILVEFYA 184 NV+ L + NF+ VI + + V FYA Sbjct: 12 NVVILDEGNFDKVIAENKLVFVNFYA 37 >SB_40719| Best HMM Match : CUB (HMM E-Value=1.2e-07) Length = 272 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/63 (28%), Positives = 27/63 (42%) Frame = +1 Query: 349 RNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANXVIVFGFFWTRAQPE 528 R+ +P+ +G DDI + L + PP E A E+ A+ +V G E Sbjct: 173 RDLTPLPGNGVPTLDDIPAVLIAEDRPPTYSEAVEEDALEMTAADVAVVHGGHTGETDTE 232 Query: 529 PKT 537 P T Sbjct: 233 PPT 235 >SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) Length = 1626 Score = 27.5 bits (58), Expect = 7.6 Identities = 21/64 (32%), Positives = 29/64 (45%) Frame = +1 Query: 337 LKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANXVIVFGFFWTR 516 L+F + S I SGG Q + W A E TSAE+A +D V + G W + Sbjct: 793 LRFKQEASEIMESGGFQ---LHKWHSNVL--EAEESTSAERANRAVDRPPVKILGIPWDK 847 Query: 517 AQPE 528 + E Sbjct: 848 NKDE 851 >SB_35488| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32) Length = 1019 Score = 27.5 bits (58), Expect = 7.6 Identities = 21/64 (32%), Positives = 29/64 (45%) Frame = +1 Query: 337 LKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANXVIVFGFFWTR 516 L+F + S I SGG Q + W A E TSAE+A +D V + G W + Sbjct: 472 LRFKQEASEIMESGGFQ---LHKWHSNVL--EAEESTSAERANRAVDRPPVKILGIPWDK 526 Query: 517 AQPE 528 + E Sbjct: 527 NKDE 530 >SB_25427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 201 ANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSR 305 +N H++TPR ++ W K+ +E ++R SR Sbjct: 91 SNAKHKDTPRPKEDWYKETQSSLAEELDDTRQRSR 125 >SB_23867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1152 Score = 27.5 bits (58), Expect = 7.6 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 183 LHGAATAN--LWHRNTPRQQQSWLKKISYQTSES*RNSR 293 L+G ATA L+ Q+Q +LKKI +T E RNSR Sbjct: 133 LNGMATAYDFLYPYMDSNQRQKYLKKIVNETRELYRNSR 171 >SB_19767| Best HMM Match : ADK (HMM E-Value=0.26) Length = 336 Score = 27.5 bits (58), Expect = 7.6 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 183 LHGAATAN--LWHRNTPRQQQSWLKKISYQTSES*RNSR 293 L+G ATA L+ Q+Q +LKKI +T E RNSR Sbjct: 10 LNGMATAYDFLYPYMDSNQRQKYLKKIVNETRELYRNSR 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,557,423 Number of Sequences: 59808 Number of extensions: 292483 Number of successful extensions: 702 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -