BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30963.Seq (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 1.2 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 1.5 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 1.5 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.0 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.7 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 4.7 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 4.7 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 4.7 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 4.7 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 4.7 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 4.7 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 4.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 4.7 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 6.2 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 6.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 6.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 6.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 6.2 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 6.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 6.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.2 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.8 bits (49), Expect = 1.2 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -3 Query: 435 SRGASLLLQPTDDVISLTTT*IVDRTAIPEEFESRVSSYTVALGEILFLSC 283 ++G L P + LTT ++ + IP+E S YT + +I C Sbjct: 270 AKGGKLACPPAIFIFDLTTDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDC 320 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 215 VPEICSGRTMEHRIQLKCTPWL*LQFQS 132 +P++CSG + I L P L L F++ Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 215 VPEICSGRTMEHRIQLKCTPWL*LQFQS 132 +P++CSG + I L P L L F++ Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.0 bits (47), Expect = 2.0 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 224 AKAATKLAEEDLLSN*RKLTQLKNRISPRATVYEDTRLS 340 A + K +DLLSN +L + S R TV RLS Sbjct: 17 ANSEAKRLYDDLLSNYNRLIRPVGNNSDRLTVKMGLRLS 55 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -1 Query: 239 LLLPWRIPVPEICSGRTMEHRIQLKCTP 156 L + W P+ EI + R +++C P Sbjct: 435 LSISWDAPITEIGGDSDLVERYEVRCYP 462 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRREL-RC 320 +L + N + R+ R+Q S+ + YQ R+ R E RC Sbjct: 29 LLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKERSRDRTERERC 76 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRRE 311 +L + + R+ R+Q+S+ + SY+ R+ RRE Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRRE 305 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/51 (21%), Positives = 24/51 (47%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRRELRCTRIP 332 +L + + R+ R+Q+S+ + SY+ R+ R+E ++ P Sbjct: 29 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRKERERSKEP 79 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/51 (23%), Positives = 23/51 (45%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRRELRCTRIP 332 +L + + R+ R+Q+S+ + SY+ R+ R E +R P Sbjct: 29 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 79 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/51 (21%), Positives = 24/51 (47%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRRELRCTRIP 332 +L + + R+ R+Q+S+ + SY+ R+ R+E ++ P Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRKERERSKEP 312 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/51 (23%), Positives = 23/51 (45%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRRELRCTRIP 332 +L + + R+ R+Q+S+ + SY+ R+ R E +R P Sbjct: 251 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 301 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/51 (23%), Positives = 23/51 (45%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRRELRCTRIP 332 +L + + R+ R+Q+S+ + SY+ R+ R E +R P Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 312 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/51 (23%), Positives = 23/51 (45%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRRELRCTRIP 332 +L + + R+ R+Q+S+ + SY+ R+ R E +R P Sbjct: 262 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 312 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/51 (23%), Positives = 23/51 (45%) Frame = +3 Query: 180 MLHGAATANLWHRNTPRQQQSWLKKISYQTSES*RNSRTGSRRELRCTRIP 332 +L + + R+ R+Q+S+ + SY+ R+ R E +R P Sbjct: 251 LLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREP 301 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/41 (21%), Positives = 21/41 (51%) Frame = +1 Query: 217 GIRQGSNKAG*RRSPIKLAKVDATQEQDLAESYGVRGYPTL 339 G ++ + + R+P+ + +E++L E+ G PT+ Sbjct: 336 GTKERTEEVALDRTPVTQGLLRVKKEEELQEAPSCGGGPTI 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,071 Number of Sequences: 438 Number of extensions: 2633 Number of successful extensions: 36 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -