BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30962.Seq (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 21 4.7 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 21 4.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.2 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 8.1 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 8.1 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 117 ASYRVLLKTALSKTDITLVFFINYLHKGKLLN 22 A +L+ S + L +F N L + KLLN Sbjct: 67 AKITTILQRYCSVLLVFLTYFFNILFRKKLLN 98 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 117 ASYRVLLKTALSKTDITLVFFINYLHKGKLLN 22 A +L+ S + L +F N L + KLLN Sbjct: 63 AKITTILQRYCSVLLVFLTYFFNILFRKKLLN 94 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 170 SCFSSLPIDNFPKSFLNLDQFTFYGELAEPFI 265 S F P+ +LN ++ TF+ EL E ++ Sbjct: 1173 SWFYDGPLIRGEVHYLNRNEETFWNELIEQYL 1204 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 170 SCFSSLPIDNFPKSFLNLDQFTFYGELAEPFI 265 S F P+ +LN ++ TF+ EL E ++ Sbjct: 1173 SWFYDGPLIRGEVHYLNRNEETFWNELIEQYL 1204 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 192 IGSDEKHDSKKSFAKDK 142 +G DE D+KK K K Sbjct: 250 VGEDEDEDTKKEDKKKK 266 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 20.6 bits (41), Expect = 8.1 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +1 Query: 58 ENQCNVRFR 84 E+QC+VRFR Sbjct: 348 EDQCDVRFR 356 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,428 Number of Sequences: 336 Number of extensions: 1915 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -