BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30962.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18690.1 68417.m02764 hypothetical protein similar to tumor-r... 32 0.25 At5g16350.1 68418.m01911 expressed protein 28 3.0 At3g27020.1 68416.m03380 oligopeptide transporter OPT family pro... 27 5.3 At5g41000.1 68418.m04984 oligopeptide transporter OPT family pro... 27 7.0 >At4g18690.1 68417.m02764 hypothetical protein similar to tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii] GI:688423 Length = 368 Score = 31.9 bits (69), Expect = 0.25 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -1 Query: 151 KRQSILDLKIQSFV*SVIKNSVVENGHYIGFL-YKLPT*RKIVK 23 KR S+L LK+ SF +IK +V G+Y L KLP R + K Sbjct: 276 KRSSLLMLKLHSFYTKIIKTCMVNFGNYFERLPVKLPNNRHVEK 319 >At5g16350.1 68418.m01911 expressed protein Length = 488 Score = 28.3 bits (60), Expect = 3.0 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 452 CSLGS-FSFDTLSLSCSIVADVAGFMNLSEILLPYTRHDRQ 333 C G+ FSF L LS S+ D ++N S+ ++ T+H Q Sbjct: 327 CRWGNYFSFIILPLSISLETDPLVYLNKSKAMMARTKHSYQ 367 >At3g27020.1 68416.m03380 oligopeptide transporter OPT family protein similar to iron-phytosiderophore transporter protein yellow stripe 1 [Zea mays] GI:10770865; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 676 Score = 27.5 bits (58), Expect = 5.3 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +2 Query: 122 YLQIEDTLSFAKDFFESCFSSLPIDNFPKSFLNLDQFTFYGELAEPFI 265 YL + S K FF + DNFP L L + TFY + + +I Sbjct: 220 YLSLSLIWSCFKWFFSGIGDACGFDNFPTLGLTLFKNTFYFDFSPTYI 267 >At5g41000.1 68418.m04984 oligopeptide transporter OPT family protein contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 670 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +2 Query: 122 YLQIEDTLSFAKDFFESCFSSLPIDNFPKSFLNLDQFTFYGELAEPFI 265 YL + S K FF + D+FP L L + TFY + + FI Sbjct: 217 YLSLSLVWSCFKWFFSGIGGACGFDHFPTLGLTLFKNTFYFDFSPTFI 264 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,286,199 Number of Sequences: 28952 Number of extensions: 158620 Number of successful extensions: 362 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -