BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30958.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 25 3.0 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 4.0 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 23 7.0 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 7.0 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 9.2 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 60 LFFDCGMLGNLINMYAAKFLIHRRSPV 140 L F+CG L I +Y + ++ R +PV Sbjct: 98 LLFECGTLYKCIFVYYSPVVLERATPV 124 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 4.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 108 AKFLIHRRSPVFLLNRVSITTKKKVHDPSEEELLPIFQY 224 +KF++ R FLL S+ TK++V +E + Y Sbjct: 1187 SKFVVFRPVDSFLLKMTSLFTKQRVRLDQDELRTSSYNY 1225 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 454 SFRYRYQYRFPNWIPF 501 +++Y Y+Y FP+ PF Sbjct: 16 AYQYSYEYEFPSSRPF 31 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 454 SFRYRYQYRFPNWIPF 501 +++Y Y+Y FP+ PF Sbjct: 16 AYQYSYEYEFPSSRPF 31 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 23.0 bits (47), Expect = 9.2 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -1 Query: 653 CIDTLLWXVQDLLCEATS 600 C+D L+W +++++ TS Sbjct: 428 CVDQLIWNIRNIVYNQTS 445 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 772,056 Number of Sequences: 2352 Number of extensions: 16454 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -