BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30955.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61215.1 68414.m06898 DNA-binding bromodomain-containing prot... 31 0.73 At3g08680.2 68416.m01009 leucine-rich repeat transmembrane prote... 29 2.2 At3g08680.1 68416.m01008 leucine-rich repeat transmembrane prote... 29 2.2 At1g58070.1 68414.m06581 expressed protein 29 3.0 At3g15600.1 68416.m01976 hypothetical protein low similarity to ... 29 3.9 At3g23980.1 68416.m03012 dentin sialophosphoprotein-related cont... 28 5.2 At2g22560.1 68415.m02674 kinase interacting protein-related simi... 28 5.2 At3g47400.1 68416.m05154 pectinesterase family protein similar t... 27 9.0 At3g44740.1 68416.m04816 tRNA synthetase class II (G, H, P and S... 27 9.0 At1g29880.1 68414.m03652 glycyl-tRNA synthetase / glycine--tRNA ... 27 9.0 At1g17530.1 68414.m02155 mitochondrial import inner membrane tra... 27 9.0 >At1g61215.1 68414.m06898 DNA-binding bromodomain-containing protein contains Pfam profile PF00439: Bromodomain Length = 475 Score = 31.1 bits (67), Expect = 0.73 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = -1 Query: 170 EDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRD 60 E K+KR+ L+AALLK++ + L+S+ +++ S D Sbjct: 75 ELKKKRVAELKAALLKSEDSIGSLESKLQSLKSESND 111 >At3g08680.2 68416.m01009 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: PF00069 Eukaryotic protein kinase domain, PF00560 leucine Rich Repeat (5 copies) Length = 640 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 457 FLYITLFLSRCIGSDNE*DKREL 525 FL +T F+SRC+ +D E DK+ L Sbjct: 10 FLLVTTFVSRCLSADIESDKQAL 32 >At3g08680.1 68416.m01008 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: PF00069 Eukaryotic protein kinase domain, PF00560 leucine Rich Repeat (5 copies) Length = 640 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 457 FLYITLFLSRCIGSDNE*DKREL 525 FL +T F+SRC+ +D E DK+ L Sbjct: 10 FLLVTTFVSRCLSADIESDKQAL 32 >At1g58070.1 68414.m06581 expressed protein Length = 284 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -1 Query: 152 IKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHE 39 +K LEA + +T+T++ L+ R + E LN E+H+ Sbjct: 133 LKKLEAEITETKTEVKMLKERESETEVALATLNAELHK 170 >At3g15600.1 68416.m01976 hypothetical protein low similarity to KED [Nicotiana tabacum] GI:8096269; contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 591 Score = 28.7 bits (61), Expect = 3.9 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = -1 Query: 191 RDFKLAIEDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHEIPESRNE 18 +DF E+++KR+K LEAA+ Q S +++ A K D E+ E ++ E Sbjct: 356 KDFSKKYEEQDKRLKLLEAAIKSIQ---SGIRTEDACGSKEIDDKENELEEGSDAETE 410 >At3g23980.1 68416.m03012 dentin sialophosphoprotein-related contains weak similarity to Dentin sialophosphoprotein precursor (Swiss-Prot:Q9NZW4) [Homo sapiens] Length = 736 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Frame = -1 Query: 179 LAIEDKEKRIKF----LEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHEIPESR 24 +++EDK R++ LE L K QT++ + + ++EK +DL I + E + Sbjct: 458 ISLEDKALRLRSNELKLERELEKAQTEMLSYKKKLQSLEKDRQDLQSTIKALQEEK 513 >At2g22560.1 68415.m02674 kinase interacting protein-related similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia]; weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum Length = 891 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = -1 Query: 179 LAIEDKEKRIKFLEAALLKTQTDLSKLQSRTATIEKISRDLNIEIHEIPE 30 +AIED+E R E A+ Q L +LQ + + +R+ +++I E E Sbjct: 180 VAIEDEEARRLMTETAIKSCQEKLVELQEKQEKSYEEAREEHVKIKESKE 229 >At3g47400.1 68416.m05154 pectinesterase family protein similar to pectinesterase (EC 3.1.1.11) from Vitis vinifera GI:15081598, Lycopersicon esculentum SP|Q43143 SP|P14280; contains Pfam profile PF01095 pectinesterase Length = 594 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 119 QTDLSKLQSRTATIEKISRDLNIEIHEIPESRNENVLDL 3 QT LS Q+ T S DLN+ +P N+N+ DL Sbjct: 192 QTWLSTAQTNIETCRSGSEDLNVSDFVMPVISNKNLSDL 230 >At3g44740.1 68416.m04816 tRNA synthetase class II (G, H, P and S) family protein similar to SP|O23627 Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) {Arabidopsis thaliana}; contains Pfam profile PF00587: tRNA synthetase class II core domain (G, H, P, S and T) Length = 276 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 163 KKSVLSFWKQHFL 125 K +VLSFW+QHF+ Sbjct: 33 KSNVLSFWRQHFI 45 >At1g29880.1 68414.m03652 glycyl-tRNA synthetase / glycine--tRNA ligase identical to SP|O23627 Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA ligase) (GlyRS) {Arabidopsis thaliana} Length = 729 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 163 KKSVLSFWKQHFL 125 K +VLSFW+QHF+ Sbjct: 154 KSNVLSFWRQHFI 166 >At1g17530.1 68414.m02155 mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein contains Pfam PF02466: Mitochondrial import inner membrane translocase subunit Tim17 Length = 187 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 529 YPAELESQFILKLPEHPAKIL-RELLKSGENLKNRLTIQDDNGYAA 663 Y ++SQ++ KLP P + E LK + LT GY A Sbjct: 24 YQVPIKSQYLYKLPTSPEFLFTEESLKQRRSWGENLTFYTGTGYLA 69 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,918,821 Number of Sequences: 28952 Number of extensions: 196747 Number of successful extensions: 541 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -