BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30952.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55851| Best HMM Match : Hydrolase (HMM E-Value=0.95) 59 4e-09 SB_35730| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06) 30 1.6 SB_13906| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40415| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_12568| Best HMM Match : Na_Ca_ex (HMM E-Value=0.0018) 29 3.6 SB_17388| Best HMM Match : rve (HMM E-Value=8.2e-17) 28 6.3 SB_42598| Best HMM Match : CtaG_Cox11 (HMM E-Value=0) 28 8.4 SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_29968| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_55851| Best HMM Match : Hydrolase (HMM E-Value=0.95) Length = 209 Score = 58.8 bits (136), Expect = 4e-09 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +1 Query: 229 RDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEV 363 R + ++ ++++AD VCFDVDSTV+ E IDELA FCG+G+EV Sbjct: 2 RQMTESETRVIWKSADAVCFDVDSTVVTGEAIDELASFCGRGEEV 46 >SB_35730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 31.5 bits (68), Expect = 0.68 Identities = 21/70 (30%), Positives = 38/70 (54%) Frame = -1 Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204 +S+ S +SS + +SSS +S + S+S + S+ NNS S ++S S+ +S Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSNNSSSSSSSSSSSSSSSSSS 255 Query: 203 STSRTAGCFS 174 S+S ++ S Sbjct: 256 SSSSSSSSSS 265 >SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06) Length = 863 Score = 30.3 bits (65), Expect = 1.6 Identities = 24/75 (32%), Positives = 41/75 (54%) Frame = -1 Query: 398 ILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*ST 219 + PP +S+ +SSP P + +SSS SS + S+S + S+ ++S S ++S Sbjct: 570 VSPPSSSS----SSSPPPASSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS---- 621 Query: 218 PVRASSTSRTAGCFS 174 +SS+S + G FS Sbjct: 622 --SSSSSSASLGYFS 634 >SB_13906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 29.9 bits (64), Expect = 2.1 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 3/119 (2%) Frame = -1 Query: 509 PVIPGVS--LTGNFXMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSS-PFPQN 339 PV+P + LT + +S+ T SL + N +A AV++ + P + Sbjct: 877 PVLPTTTSVLTSSMESSSMA-TTSTSSTPSLESSMTTNSTTSTLAEAVAISSLVLPTTTS 935 Query: 338 LASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSNCKE 162 + +SSM SS M STS T S + + S +T + P+ +S +S T ++ E Sbjct: 936 VLTSSMESSSMATTSTS-STPSFESSMTTNSTTSTPAEAVPISSSVSSTTTSVLTSSME 993 >SB_40415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1512 Score = 29.9 bits (64), Expect = 2.1 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Frame = -1 Query: 389 PIASAVSLLTSSPFP-QNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213 P+A + SL +SS + + LAS S SC +VE+ S + + N+ +S S P+ Sbjct: 886 PLAPSTSLTSSSAYSTEGLASGSESGSCPSVEA-SAEAKDCDNNSYSESDSPRREYSDPM 944 Query: 212 RA---SSTSRTAGCFSNCKEPS 156 R SS ++ S+ PS Sbjct: 945 RGYPNSSIDNSSEADSSLGSPS 966 >SB_12568| Best HMM Match : Na_Ca_ex (HMM E-Value=0.0018) Length = 349 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 253 DSLLGRHHADRHQ*ERLQRRVL 188 DS ADRH+ ER+QRRVL Sbjct: 55 DSKAAERRADRHRQERIQRRVL 76 >SB_17388| Best HMM Match : rve (HMM E-Value=8.2e-17) Length = 441 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -3 Query: 321 AFILYDGRVYIEANAVRCPEQLRTVCWGDITLIDTSESVFNVAYCR 184 A ++ G Y+ A PEQ T CW LI S+ + YCR Sbjct: 110 ANVVLRGPTYLRKTASALPEQTATACW---RLIHLSQCI-ETHYCR 151 >SB_42598| Best HMM Match : CtaG_Cox11 (HMM E-Value=0) Length = 1498 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +1 Query: 187 AVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFD 291 A + A+TG+ +V P + + F C CF+ Sbjct: 1413 ATNATDTAITGISTYNVIPFEAGQYFNKIQCFCFE 1447 >SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -1 Query: 326 SMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSNCKEPS 156 S+ SSC +VES + V +S S + ++P R T+ A S+C++ S Sbjct: 691 SLTSSCPSVESEPVRQVVHVQIHSSDSDSEKCKETSPTRRKETANLACSQSDCEDAS 747 >SB_29968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 27.9 bits (59), Expect = 8.4 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = -1 Query: 362 TSSPFPQNLASSSMPSSCMTVESTSKQTQSAVL---NNSGQSVGATSR*STPVRASSTSR 192 T PFP ASSS+ + T E T + + + G S+G +RASST Sbjct: 235 TLDPFPTKTASSSISNKGHTAEKTGYKGITTFIVPRETPGLSIGKKED-KLGIRASSTCP 293 Query: 191 TAGCFSNCKEPS 156 F N K PS Sbjct: 294 VH--FDNVKVPS 303 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,592,523 Number of Sequences: 59808 Number of extensions: 378991 Number of successful extensions: 1254 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1249 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -