BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30947.Seq (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.16c |||phospholipase D |Schizosaccharomyces pombe|chr 1|... 26 4.8 >SPAC2F7.16c |||phospholipase D |Schizosaccharomyces pombe|chr 1|||Manual Length = 1369 Score = 25.8 bits (54), Expect = 4.8 Identities = 14/62 (22%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = +3 Query: 204 KSARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKE-TQNVKSQXLQ---KWRT 371 K+ +AG S KP+ + G+ VP ++ + + + ++ Q ++ KW + Sbjct: 1288 KNPKAGSQGSGNTSASEDSKTEKPKTRTNNGLQVPDKRVVYDLLRGIRGQLVELPLKWMS 1347 Query: 372 TE 377 TE Sbjct: 1348 TE 1349 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,891,690 Number of Sequences: 5004 Number of extensions: 29969 Number of successful extensions: 69 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -