BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30946.Seq (558 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.28 SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) 29 2.6 SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) 28 5.9 SB_16700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_48437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 55.6 bits (128), Expect = 3e-08 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%) Frame = +1 Query: 4 SVKVHPVVLFQIVDAYERRN--ADSHRVIGTLLGTSDKGVVEVTNCFCVPHKE-HADQVE 174 +V VHP+VL +VD + R RV+G LLG+ KGV++V NCF VP E DQ Sbjct: 10 TVVVHPIVLLSVVDHFNRMGKVGSQKRVVGVLLGSRRKGVLDVANCFAVPFDEDDRDQNV 69 Query: 175 --AELNYAMDVYELNRRVN 225 + +Y ++Y + ++VN Sbjct: 70 WFLDHDYLENMYAMFKKVN 88 >SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = +1 Query: 7 VKVHPVVLFQIVDAYERRNADSHRVIGTLLGTSDKGVVEVTNCFCVP-HKEHADQVEAEL 183 V+V + + +I+ E + V G LLG +E+TNCF P +K D+ + ++ Sbjct: 18 VQVDGLTVLKIIKHCEEEGSSGDLVQGVLLGLIQDNRLEITNCFPFPSNKAGDDEDDDDV 77 Query: 184 NYAMDVYELNRRVNSSESIVGWW 252 NY M+V R VN VGW+ Sbjct: 78 NYQMEVMRRLRAVNIDHLHVGWY 100 >SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 32.3 bits (70), Expect = 0.28 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 169 VEAELNYAMDVYELNRRVNSSESIVGWWALAMK*PTTPLLYTSI 300 V EL YA +YEL+++ N +E IVG + + T +++ I Sbjct: 1 VAVELEYAKSMYELSQKANPNEQIVGCVKMGVPGKTEGTMFSQI 44 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 387 VPLGVPNGKQGCMXTPVDVTLTCYEPEIVGLQVCQKTVS 503 V +GVP +G M + + + PE VG+ V Q+T S Sbjct: 28 VKMGVPGKTEGTMFSQIPCEVKLTGPEKVGVDVLQRTKS 66 >SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) Length = 219 Score = 29.1 bits (62), Expect = 2.6 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = -3 Query: 238 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 59 Y+ + CS + PSR +P R R + +R+ W++ +CR P R L ++F Sbjct: 36 YYNYRHVRCSRSREPSR--IPKRFLRRIHNKSRKLRWVVYHRICRKIP-RSSNLHNYINF 92 Query: 58 DVRMRPQFEIK 26 R F+ K Sbjct: 93 GRLRRRYFDSK 103 >SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 28.3 bits (60), Expect = 4.5 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -3 Query: 238 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 59 Y+ + CS + PSR +P R R + +R+ W++ +CR+ P R L ++F Sbjct: 90 YYNYRHVRCSRSREPSR--IPKRFLRRLHNKSRKLRWVVYHRICRNIP-RSSNLHNYINF 146 Query: 58 D-VRMRP 41 +R RP Sbjct: 147 GRLRRRP 153 >SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) Length = 419 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 6 CEGPSCCFISNCGRIRTSKCRF 71 C G + CFI R R KCRF Sbjct: 78 CRGSNDCFIDKVHRNRCQKCRF 99 >SB_16700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 5.9 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -2 Query: 368 THSTSSQRSVQSXMDRLTAFTGIILVYNRGVVGYFIASAHQ 246 T S S RS+ + L +T I+ YN+ ++ F++S H+ Sbjct: 83 TRSIPSIRSITKLYNVLPIYTLILRPYNQWIIQRFLSSTHK 123 >SB_48437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4247 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = -1 Query: 432 EXTCNLAFHLALPMVXXHMHVNPFDLQPAKCPE*XGQAHGIHG 304 E C+L HL P++ +H+ P CP + + G Sbjct: 3007 ELWCDLNIHLPTPVLMHEVHIQPHTAGLTTCPSYVALDYSVDG 3049 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,952,010 Number of Sequences: 59808 Number of extensions: 428052 Number of successful extensions: 1218 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1216 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -