BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30946.Seq (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39990.1 68415.m04914 eukaryotic translation initiation facto... 81 5e-16 At5g05780.1 68418.m00636 26S proteasome non-ATPase regulatory su... 74 7e-14 At3g11270.1 68416.m01370 26S proteasome non-ATPase regulatory su... 73 1e-13 At1g10840.1 68414.m01246 eukaryotic translation initiation facto... 49 2e-06 At5g01240.2 68418.m00032 amino acid permease, putative strong si... 30 0.91 At5g01240.1 68418.m00031 amino acid permease, putative strong si... 30 0.91 >At2g39990.1 68415.m04914 eukaryotic translation initiation factor 3 subunit 5 / eIF-3 epsilon / eIF3f (TIF3F1) identical to SP|O04202 Eukaryotic translation initiation factor 3 subunit 5 (eIF-3 epsilon) (eIF3 p32 subunit) (eIF3f) {Arabidopsis thaliana}; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 293 Score = 81.0 bits (191), Expect = 5e-16 Identities = 34/86 (39%), Positives = 58/86 (67%), Gaps = 1/86 (1%) Frame = +1 Query: 1 ISVKVHPVVLFQIVDAYERRNADSHRVIGTLLGTS-DKGVVEVTNCFCVPHKEHADQVEA 177 ++ ++HP+V+F + D + RR + RVIGTLLG+ G V++ N + VPH E +DQV Sbjct: 26 LTARIHPLVIFNVCDCFVRRPDSAERVIGTLLGSILPDGTVDIRNSYAVPHNESSDQVAV 85 Query: 178 ELNYAMDVYELNRRVNSSESIVGWWA 255 +++Y ++ + +VNS E+IVGW++ Sbjct: 86 DIDYHHNMLASHLKVNSKETIVGWYS 111 Score = 50.4 bits (115), Expect = 8e-07 Identities = 26/81 (32%), Positives = 41/81 (50%) Frame = +3 Query: 255 TGNEVTNHSSVIHEYYSRECREPVHXTLDTSLAGGRMGLRAYVXVPLGVPNGKQGCMXTP 434 TG V SS+IH++Y+RE P+H T+DT G ++A+V L + + + Sbjct: 112 TGAGVNGGSSLIHDFYAREVPNPIHLTVDTGFTNGEGTIKAFVSSNLSLGDRQLVAHFQE 171 Query: 435 VDVTLTCYEPEIVGLQVCQKT 497 + V L + E VG V + T Sbjct: 172 IPVDLRMVDAERVGFDVLKAT 192 >At5g05780.1 68418.m00636 26S proteasome non-ATPase regulatory subunit 7, putative / 26S proteasome regulatory subunit S12, putative / MOV34 protein, putative contains similarity to 26s proteasome regulatory subunit s12 (proteasome subunit p40) (mov34 protein) SP:P26516 from [Mus musculus]; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 308 Score = 73.7 bits (173), Expect = 7e-14 Identities = 38/91 (41%), Positives = 55/91 (60%), Gaps = 4/91 (4%) Frame = +1 Query: 7 VKVHPVVLFQIVDAYERRNADSH-RVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVE--- 174 V VHP+VL IVD Y R DS RV+G LLG+S +GVV+VTN + VP +E Sbjct: 17 VVVHPLVLLSIVDHYNRVAKDSSKRVVGVLLGSSSRGVVDVTNSYAVPFEEDDKDPSIWF 76 Query: 175 AELNYAMDVYELNRRVNSSESIVGWWALAMK 267 + NY ++ + +R+N+ E +VGW++ K Sbjct: 77 LDHNYHESMFHMFKRINAKEHVVGWYSTGPK 107 >At3g11270.1 68416.m01370 26S proteasome non-ATPase regulatory subunit 7, putative / 26S proteasome regulatory subunit S12, putative / MOV34 protein, putative contains similarity to 26S proteasome regulatory subunit S12 (MOV34) SP:P26516 from [Mus musculus] Length = 310 Score = 72.9 bits (171), Expect = 1e-13 Identities = 38/91 (41%), Positives = 54/91 (59%), Gaps = 4/91 (4%) Frame = +1 Query: 7 VKVHPVVLFQIVDAYERRNAD-SHRVIGTLLGTSDKGVVEVTNCFCVPHKEHADQVE--- 174 V VHP+VL IVD Y R D S RV+G LLG+S +G V+VTN + VP +E Sbjct: 17 VIVHPLVLLSIVDHYNRVAKDTSKRVVGVLLGSSSRGTVDVTNSYAVPFEEDDKDTSIWF 76 Query: 175 AELNYAMDVYELNRRVNSSESIVGWWALAMK 267 + NY ++ + +R+N+ E IVGW++ K Sbjct: 77 LDHNYHESMFHMFKRINAKEHIVGWYSTGPK 107 >At1g10840.1 68414.m01246 eukaryotic translation initiation factor 3 subunit 3 / eIF-3 gamma / eIF3h (TIF3H1) identical to SP|Q9C5Z2 Eukaryotic translation initiation factor 3 subunit 3 (eIF-3 gamma) (eIF3 p38 subunit) (eIF3h) {Arabidopsis thaliana}; contains Pfam profile PF01398: Mov34/MPN/PAD-1 family Length = 337 Score = 48.8 bits (111), Expect = 2e-06 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 79 VIGTLLGTSDKGVVEVTNCFCVPHKEHADQVEAE-LNYAMDVYELNRRVNSSESIVGWW 252 V G LLG V+EVTNCF P ++ +++EA+ NY +++ R VN + VGW+ Sbjct: 47 VTGQLLGLDVGSVLEVTNCFPFPVRDDDEEIEADGANYQLEMMRCLREVNVDNNTVGWY 105 >At5g01240.2 68418.m00032 amino acid permease, putative strong similarity to AUX1 GI:1531758 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 408 Score = 30.3 bits (65), Expect = 0.91 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -1 Query: 222 DSSVQLVNIHRVIKFRFDLIGMFFVWHAEAVGYFH 118 D++V L+ IH+ I F F ++FVW +A+G H Sbjct: 238 DTAVILMLIHQFITFGFACTPLYFVWE-KAIGMHH 271 >At5g01240.1 68418.m00031 amino acid permease, putative strong similarity to AUX1 GI:1531758 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 488 Score = 30.3 bits (65), Expect = 0.91 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -1 Query: 222 DSSVQLVNIHRVIKFRFDLIGMFFVWHAEAVGYFH 118 D++V L+ IH+ I F F ++FVW +A+G H Sbjct: 318 DTAVILMLIHQFITFGFACTPLYFVWE-KAIGMHH 351 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,926,371 Number of Sequences: 28952 Number of extensions: 277797 Number of successful extensions: 641 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -