BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30943.Seq (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 3.2 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 3.2 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 3.2 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 5.5 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 9.7 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 9.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 9.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 9.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 9.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 9.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 9.7 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 21 9.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 9.7 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 22.6 bits (46), Expect = 3.2 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = -1 Query: 182 TGPRELFTMFAIAAAAHYILCSHWVSAGSCPCYRQRCSYSRHFLLYF*HKIHFKIAVT 9 TG R+++ H S+ A RQR +Y+RH +L + H+ +T Sbjct: 205 TGDRQIYPWMR---KVHVAGASNGTFAPGMEPKRQRTAYTRHQILELEKEFHYNRYLT 259 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.6 bits (46), Expect = 3.2 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = -1 Query: 182 TGPRELFTMFAIAAAAHYILCSHWVSAGSCPCYRQRCSYSRHFLLYF*HKIHFKIAVT 9 TG R+++ H S+ A RQR +Y+RH +L + H+ +T Sbjct: 205 TGDRQIYPWMR---KVHVAGASNGTFAPGMEPKRQRTAYTRHQILELEKEFHYNRYLT 259 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.6 bits (46), Expect = 3.2 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = -1 Query: 182 TGPRELFTMFAIAAAAHYILCSHWVSAGSCPCYRQRCSYSRHFLLYF*HKIHFKIAVT 9 TG R+++ H S+ A RQR +Y+RH +L + H+ +T Sbjct: 205 TGDRQIYPWMR---KVHVAGASNGTFAPGMEPKRQRTAYTRHQILELEKEFHYNRYLT 259 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 54 KMSTIAAPLSVAGTRSCGDPVRTQNV 131 K+STIA L V TRS P T+ + Sbjct: 36 KLSTIALALGVERTRSELIPFLTETI 61 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 167 LFTMFAIAAAAHYILCSHWV 108 LFT+F + AH + +V Sbjct: 2 LFTVFLVLTCAHVVFLEEYV 21 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 83 RQRCSYSRHFLLYF*HKIHFKIAVT 9 RQR SY+R+ L + HF +T Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLT 246 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 83 RQRCSYSRHFLLYF*HKIHFKIAVT 9 RQR SY+R+ L + HF +T Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLT 246 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 83 RQRCSYSRHFLLYF*HKIHFKIAVT 9 RQR SY+R+ L + HF +T Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLT 246 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 83 RQRCSYSRHFLLYF*HKIHFKIAVT 9 RQR SY+R+ L + HF +T Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLT 246 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 83 RQRCSYSRHFLLYF*HKIHFKIAVT 9 RQR SY+R+ L + HF +T Sbjct: 178 RQRTSYTRYQTLELEKEFHFNRYLT 202 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 83 RQRCSYSRHFLLYF*HKIHFKIAVT 9 RQR SY+R+ L + HF +T Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLT 246 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 83 RQRCSYSRHFLLYF*HKIHFKIAVT 9 RQR SY+R+ L + HF +T Sbjct: 10 RQRTSYTRYQTLELEKEFHFNRYLT 34 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 83 RQRCSYSRHFLLYF*HKIHFKIAVT 9 RQR SY+R+ L + HF +T Sbjct: 222 RQRTSYTRYQTLELEKEFHFNRYLT 246 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,891 Number of Sequences: 336 Number of extensions: 3663 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -