BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30940.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) 33 0.17 SB_24093| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-13) 29 2.7 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_25341| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_56935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_39624| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_3179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 28 8.4 SB_3463| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +1 Query: 373 KGFEAAGVTGPGGEPVKGSPYAADKRRGYHR 465 +G EA+ VTGP GEPV+GS YA D+RR +R Sbjct: 13 QGLEASNVTGPDGEPVQGSKYAPDRRRRNNR 43 >SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) Length = 80 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 185 IAEKVSGTVKWFNVKSGYGFI 247 ++ + +GTVKWFN + GYGFI Sbjct: 12 MSNRQNGTVKWFNDEKGYGFI 32 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +1 Query: 265 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396 +D+FVH AI + +S+ +G+AV F G+KG +A V Sbjct: 38 DDLFVHFKAIQSDG----FKSLKEGQAVTFVATRGQKGMQAEEV 77 >SB_24093| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-13) Length = 305 Score = 29.5 bits (63), Expect = 2.7 Identities = 23/107 (21%), Positives = 45/107 (42%) Frame = -3 Query: 540 VHDVLILLCVDSFTASSATLTREILAVVATALVCSIR*AFYWLTTGTSNTSCFKAFLPGN 361 +HD + + SF S+ L+ LA V+ + ++ FY TG + F L G Sbjct: 90 IHDAFYIFVLPSFAVFSSFLSVNFLAAVSVERLVAVTFPFYHRVTGKT----FYGLLIGT 145 Query: 360 HGKLHRLSVADRAHSLTWVVTGDGSLMHKHIFLGVILLMKPYPLLTL 220 L +S T V+ + ++FL ++++ Y ++ + Sbjct: 146 PWLLAGISTVTTVCLPTPVIDISITFFVIYVFLPLLIMSAAYTVIMI 192 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 29.1 bits (62), Expect = 3.6 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +1 Query: 295 ARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG-EPVKGSPYAADKRRG 456 AR +AVR GE +V G G G G GG E V+G+PY ++ G Sbjct: 395 AREYLARAVREGLRGEEGSPSVFLGGGGRGGGGGDGGGGGEGVQGTPYTPEEEEG 449 >SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 575 GSRRRALYHLQRIFSVAIFAVDALGEVLA 661 G + L+ ++R + + AVDALG+VLA Sbjct: 296 GCTKEDLFEMERKLGIKLVAVDALGKVLA 324 >SB_27173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1206 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 575 GSRRRALYHLQRIFSVAIFAVDALGEVL 658 G + L+ ++R F V + AVDALG VL Sbjct: 296 GCTKEDLFEMKRKFEVNLVAVDALGNVL 323 >SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 414 ASKRLTLCCRQAPWLPP 464 AS T+C RQAPWL P Sbjct: 19 ASPTWTICLRQAPWLSP 35 >SB_25341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 661 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 575 GSRRRALYHLQRIFSVAIFAVDALGEVL 658 G + L+ ++R F V + AVDALG VL Sbjct: 366 GCTKEDLFEMKRKFEVNLVAVDALGNVL 393 >SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 425 AHLMLQTSAVATTANISLV-KVADEAVKESTQRRIRTSWTPA 547 AH M SA TTA S + + D ++E+T+R W A Sbjct: 52 AHSMATRSATQTTAETSFITEEVDAVIQENTERVQELQWVVA 93 >SB_56935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +2 Query: 554 KGCTRRXG--SRRRALYHLQRIFSVAIFAVDALGEVL 658 +G +R G R L+ ++R V + AVDALG VL Sbjct: 209 RGTSRSLGLTKTREDLFEMERKLEVKLVAVDALGNVL 245 >SB_39624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 575 GSRRRALYHLQRIFSVAIFAVDALGEVL 658 G R L+ +++ V + AVDALG VL Sbjct: 277 GCTREGLFEMEKKLEVKLVAVDALGNVL 304 >SB_3179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 575 GSRRRALYHLQRIFSVAIFAVDALGEVL 658 G ++ L+ ++R V + AVDALG VL Sbjct: 52 GCTKKDLFEMERKLEVKLVAVDALGNVL 79 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 575 GSRRRALYHLQRIFSVAIFAVDALGEVL 658 G ++ L+ ++R V + AVDALG VL Sbjct: 233 GCTKKDLFEMERKLEVKLVAVDALGNVL 260 >SB_3463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 575 GSRRRALYHLQRIFSVAIFAVDALGEVL 658 G R L+ +++ V + AVDALG VL Sbjct: 349 GCTREGLFEMEKKLEVKLVAVDALGNVL 376 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,534,231 Number of Sequences: 59808 Number of extensions: 307890 Number of successful extensions: 1172 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1171 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -