BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30939.Seq (504 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0314 - 33077621-33077869,33078218-33078280,33079392-330794... 105 3e-23 07_01_0604 - 4491884-4491993,4493030-4493225,4494269-4494326,449... 73 1e-13 01_06_0536 + 30068881-30070383 28 4.9 04_03_0501 + 16593710-16593886,16595255-16595311,16595748-165974... 27 6.5 05_01_0213 - 1606383-1606816,1607695-1608355 27 8.6 >03_06_0314 - 33077621-33077869,33078218-33078280,33079392-33079449, 33079534-33079688,33079797-33080106,33080634-33080890, 33081280-33081359,33083888-33083948 Length = 410 Score = 105 bits (251), Expect = 3e-23 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +1 Query: 262 VGSIVGIYNGKTFNQVEIKXEMXGXYLGEFSVTYKXVKHGRPGIGVTHSSRFIPLK 429 +GSIVG+YNGKTFNQVEIK EM G YL EFS++YK VKHGRPGIG THSSRFIPLK Sbjct: 355 IGSIVGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 410 Score = 66.9 bits (156), Expect = 9e-12 Identities = 35/58 (60%), Positives = 41/58 (70%) Frame = +3 Query: 12 PRKSVFSGSSLTRGVDLDQLLDMXNEQLMELMHARARXRFARGLKRKXMALVKXLRRA 185 P+K F S RGVDLD LLDM + L++L ARAR RF RGLKRK MAL+K LR+A Sbjct: 251 PKKRTFRKYSY-RGVDLDALLDMSTDDLVQLFPARARRRFQRGLKRKPMALIKKLRKA 307 >07_01_0604 - 4491884-4491993,4493030-4493225,4494269-4494326, 4494459-4494613,4495092-4495115,4495377-4495489, 4499943-4500129 Length = 280 Score = 73.3 bits (172), Expect = 1e-13 Identities = 38/62 (61%), Positives = 45/62 (72%) Frame = +3 Query: 12 PRKSVFSGSSLTRGVDLDQLLDMXNEQLMELMHARARXRFARGLKRKXMALVKXLRRAKK 191 P+K F S RGVDLD LLDM + L++L ARAR RF RGLKRK MAL+K LR+AKK Sbjct: 123 PKKRTFRKYSY-RGVDLDALLDMSTDDLVQLFPARARRRFQRGLKRKPMALIKKLRKAKK 181 Query: 192 EA 197 +A Sbjct: 182 DA 183 Score = 70.5 bits (165), Expect = 7e-13 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 262 VGSIVGIYNGKTFNQVEIKXEMXGXYLGEFSVTYKXVKH 378 +GSIVG+YNGKTFNQVEIK EM G YL EFS++YK VKH Sbjct: 206 IGSIVGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKH 244 >01_06_0536 + 30068881-30070383 Length = 500 Score = 27.9 bits (59), Expect = 4.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 504 YTSYFIVXSCKFXVTLSLEVVLDALLERNEP 412 Y SY ++ +C F + E +++ LLE N P Sbjct: 163 YCSYLLLENCMFGRQIEQERIINFLLEPNHP 193 >04_03_0501 + 16593710-16593886,16595255-16595311,16595748-16597469, 16599045-16599326,16599521-16599637,16599655-16600365 Length = 1021 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 72 LDMXNEQLMELMHARARXRFARGLKRKXMALVKXLRRAKKEA 197 +DM ++ L ARAR RG K K A K L A++ A Sbjct: 160 VDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARRLA 201 >05_01_0213 - 1606383-1606816,1607695-1608355 Length = 364 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 Query: 386 PVSVLHTAQGSFRSSRASKTTSRLSVT 466 PVSVLH S SS +S TT+ + T Sbjct: 176 PVSVLHAQHSSSSSSSSSTTTTTTTTT 202 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,035,237 Number of Sequences: 37544 Number of extensions: 119215 Number of successful extensions: 154 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -