BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30939.Seq (504 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81077-5|CAB03065.1| 151|Caenorhabditis elegans Hypothetical pr... 101 4e-22 >Z81077-5|CAB03065.1| 151|Caenorhabditis elegans Hypothetical protein F36A2.6 protein. Length = 151 Score = 101 bits (241), Expect = 4e-22 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = +1 Query: 262 VGSIVGIYNGKTFNQVEIKXEMXGXYLGEFSVTYKXVKHGRPGIGVTHSSRFIPLK 429 VG ++GIYNGK FNQ EIK EM G YLGEF+++YK VKHGRPGIG THSSRFIPLK Sbjct: 96 VGGVIGIYNGKVFNQTEIKPEMIGFYLGEFAISYKPVKHGRPGIGATHSSRFIPLK 151 Score = 60.5 bits (140), Expect = 7e-10 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +3 Query: 48 RGVDLDQLLDMXNEQLMELMHARARXRFARGLKRKXMALVKXLRRAKKEA 197 RGVDLDQLLDM EQ +L+ R R R RGLKRK +AL+ +++AKK A Sbjct: 24 RGVDLDQLLDMSREQFTKLLPCRMRRRLDRGLKRKHLALIAKVQKAKKAA 73 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,596,679 Number of Sequences: 27780 Number of extensions: 100610 Number of successful extensions: 176 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 967231538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -