BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30936.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 37 7e-04 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 33 0.011 EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. 28 0.25 AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha su... 27 0.75 AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha su... 27 0.75 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 26 0.99 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 25 2.3 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 25 2.3 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 25 2.3 AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 25 3.0 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 23 7.0 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 9.2 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 36.7 bits (81), Expect = 7e-04 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = +3 Query: 282 TTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYW-RCYYGNTDAIIYVVDSADRXRIGI 458 T + T G ++K++ F+++D+GGQ S R W C+ G T AII+ V + + Sbjct: 176 TRVKTTGIVETHFSFKSIHFKMFDVGGQRSERKKWIHCFEGVT-AIIFCVALSGYDLVLA 234 Query: 459 SKDELVHML 485 +E+ M+ Sbjct: 235 EDEEMNRMI 243 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 184 GLLGAREMRILILGLDGAGKTTILINCKSV 273 G A E+++L+LG +GK+TI+ K + Sbjct: 26 GERAASEVKLLLLGAGESGKSTIVKQMKII 55 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 32.7 bits (71), Expect = 0.011 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +3 Query: 288 IPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRXRI 452 +PT G + ++F++ D+GGQ S R W + N +II++V ++ +I Sbjct: 178 VPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQI 232 Score = 23.4 bits (48), Expect = 7.0 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +1 Query: 199 REMRILILGLDGAGKTTIL 255 RE+++L+LG +GK+T + Sbjct: 32 RELKLLLLGTGESGKSTFI 50 >EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. Length = 213 Score = 28.3 bits (60), Expect = 0.25 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 333 LKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 431 +KF++WD GQ YY A I V D Sbjct: 73 VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYD 105 >AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha subunit AgOn protein. Length = 134 Score = 26.6 bits (56), Expect = 0.75 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +1 Query: 184 GLLGAREMRILILGLDGAGKTTILINCKSV 273 G+ A+++++L+LG +GK+TI+ K + Sbjct: 14 GIQAAKDIKLLLLGAGESGKSTIVKQMKII 43 >AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha subunit AgOa protein. Length = 134 Score = 26.6 bits (56), Expect = 0.75 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +1 Query: 184 GLLGAREMRILILGLDGAGKTTILINCKSV 273 G+ A+++++L+LG +GK+TI+ K + Sbjct: 14 GIQAAKDIKLLLLGAGESGKSTIVKQMKII 43 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 26.2 bits (55), Expect = 0.99 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 333 LKFQVWDLGGQTSIRPYWRCYYGNTDAIIYV 425 + F ++D+GGQ R W + + AII+V Sbjct: 206 VNFHMFDVGGQRDERRKWIQCFNDVTAIIFV 236 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 211 ILILGLDGAGKTTILINCKSVRS*P 285 + ++G GAGKTT L+N + RS P Sbjct: 129 LAVMGSSGAGKTT-LLNALAFRSPP 152 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 211 ILILGLDGAGKTTILINCKSVRS*P 285 + ++G GAGKTT L+N + RS P Sbjct: 129 LAVMGSSGAGKTT-LLNALAFRSPP 152 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 211 ILILGLDGAGKTTILINCKSVRS*P 285 + ++G GAGKTT L+N + RS P Sbjct: 107 LAVMGSSGAGKTT-LLNALAFRSPP 130 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 24.6 bits (51), Expect = 3.0 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +3 Query: 183 RIAG---CKGNADFDTWIGRCRKDDNSYKLQVGEVV 281 R+AG C+G + W+ R R+ N Y Q ++V Sbjct: 181 RMAGYDPCEGRPNLTQWMARVRESTNPYYDQAHKLV 216 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 69 FFVLIYTWSTLNILFNNKY 13 F LIY + T ++LFN Y Sbjct: 425 FVFLIYDYGTRSVLFNGVY 443 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = -1 Query: 431 VYNIYYCICVAI--VTSPIRP--NTGLSPKIPHLE 339 ++ I +C C+ I P TG+SP PH E Sbjct: 408 IHRIQHCTCMLQNNARESISPASGTGMSPSYPHSE 442 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 705,345 Number of Sequences: 2352 Number of extensions: 13874 Number of successful extensions: 48 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -