BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30934.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 83 2e-16 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 83 2e-16 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 83 2e-16 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 83 2e-16 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 83 2e-16 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 77 9e-15 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 73 2e-13 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 62 3e-10 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 58 7e-09 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 58 7e-09 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 56 2e-08 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 50 2e-06 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 50 2e-06 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 41 7e-04 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 38 0.005 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 37 0.011 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 37 0.011 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 37 0.011 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 37 0.015 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 36 0.020 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 36 0.026 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 36 0.026 At1g34780.1 68414.m04329 protein disulfide isomerase-related con... 36 0.026 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 36 0.034 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 35 0.045 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 35 0.045 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 35 0.045 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 34 0.079 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 34 0.079 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 33 0.14 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 33 0.24 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 33 0.24 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 32 0.32 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 32 0.32 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 31 0.73 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 31 0.73 At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P... 31 0.73 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 31 0.73 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 31 0.73 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 31 0.97 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 31 0.97 At4g08930.1 68417.m01470 thioredoxin-related contains weak simil... 31 0.97 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 30 1.3 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 30 1.7 At3g19780.1 68416.m02504 expressed protein 30 1.7 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 30 1.7 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 30 1.7 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 30 1.7 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 29 2.2 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 29 3.0 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 29 3.0 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 29 3.0 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 29 3.0 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 29 3.9 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 29 3.9 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 28 5.2 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 28 5.2 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 6.8 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 28 6.8 At1g16230.1 68414.m01944 syntaxin-related family protein similar... 28 6.8 At4g08710.1 68417.m01439 hypothetical protein contains Pfam prof... 27 9.0 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 27 9.0 At2g34680.1 68415.m04260 leucine-rich repeat family protein cont... 27 9.0 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 27 9.0 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 82.6 bits (195), Expect = 2e-16 Identities = 33/84 (39%), Positives = 58/84 (69%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 439 + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213 Query: 440 VTSAEQAKELIDANTVIVFGFFST 511 +T+ + A++++ + +V G+ ++ Sbjct: 214 LTTLDDAEKVLTSGNKVVLGYLNS 237 Score = 64.5 bits (150), Expect = 6e-11 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 4/54 (7%) Frame = +3 Query: 66 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAP Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAP 140 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/47 (42%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Frame = +3 Query: 84 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAP 215 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEP 479 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 82.6 bits (195), Expect = 2e-16 Identities = 33/84 (39%), Positives = 58/84 (69%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 439 + LAK+DAT+E +LA+ Y V+G+PTL FF +G Y+GGR + I++W+KKK GP Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213 Query: 440 VTSAEQAKELIDANTVIVFGFFST 511 +T+ + A++++ + +V G+ ++ Sbjct: 214 LTTLDDAEKVLTSGNKVVLGYLNS 237 Score = 64.5 bits (150), Expect = 6e-11 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 4/54 (7%) Frame = +3 Query: 66 LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 LG D +PT E++V+V+ + NF VI +Y+LVEFYAPWCGHC+SLAP Sbjct: 87 LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAP 140 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/47 (42%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Frame = +3 Query: 84 DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAP 215 D +P +E+V ++ NF E V+ ++ +L+E YAPWCGHC++L P Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEP 479 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 82.6 bits (195), Expect = 2e-16 Identities = 38/87 (43%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +2 Query: 257 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTG 424 P+ LAK+DA++E ++ A Y ++G+PTLK RNG S DY+G R+A+ I+++LKK++G Sbjct: 81 PLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSG 140 Query: 425 PPAVEVTSAEQAKELIDANTVIVFGFF 505 P +VE+ SA+ A E++ V+ G F Sbjct: 141 PASVEIKSADSATEVVGEKNVVAVGVF 167 Score = 58.8 bits (136), Expect = 3e-09 Identities = 27/58 (46%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = +3 Query: 48 FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 F+ + LL L + T+E VL L +NF I+ ++I+VEFYAPWCGHC+ LAP Sbjct: 9 FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAP 66 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 90 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 +P E N +V++++ + V + + +L+EFYAPWCGHC+ LAP Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +2 Query: 266 LAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 421 +AK+DAT ++++ V+G+PT+ F +G+ + Y G R +D I++++K + Sbjct: 427 IAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 82.6 bits (195), Expect = 2e-16 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +2 Query: 257 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 424 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 425 PPAVEVTSAEQAKELIDANTVIVFGFF 505 P + E+ SA+ A E++ V+V G F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168 Score = 62.1 bits (144), Expect = 3e-10 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Frame = +3 Query: 48 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 209 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 210 AP 215 AP Sbjct: 66 AP 67 Score = 48.0 bits (109), Expect = 6e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 90 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 35.1 bits (77), Expect = 0.045 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 412 + +AK+DAT +++ V+G+PT+ F +G+ + Y G RQ + + +++ Sbjct: 427 VVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 82.6 bits (195), Expect = 2e-16 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%) Frame = +2 Query: 257 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 424 P+ LAK+DA++E ++ A Y V+G+PT+K FRNG +Y+G R+A+ I+++LKK++G Sbjct: 82 PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141 Query: 425 PPAVEVTSAEQAKELIDANTVIVFGFF 505 P + E+ SA+ A E++ V+V G F Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168 Score = 62.1 bits (144), Expect = 3e-10 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Frame = +3 Query: 48 FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 209 FT ++L L+L +E T+E VL L NF I ++I+VEFYAPWCGHCK L Sbjct: 6 FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65 Query: 210 AP 215 AP Sbjct: 66 AP 67 Score = 48.0 bits (109), Expect = 6e-06 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = +3 Query: 90 VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 +P E N +V+S + + V+ + + +L+EFYAPWCGHC+ LAP Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 4/73 (5%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKK---TGP 427 + +AK+DAT +++ V+G+PT+ F +G+ + Y G R +D IS++ K G Sbjct: 427 VVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTVGE 486 Query: 428 PAVEVTSAEQAKE 466 P E + E+ K+ Sbjct: 487 PKKEEETTEEVKD 499 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 77.4 bits (182), Expect = 9e-15 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 1/83 (1%) Frame = +2 Query: 266 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 442 LAK+DAT+E DLA+ Y ++G+PT+ F +G Y G R D I++WLKKK P + Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210 Query: 443 TSAEQAKELIDANTVIVFGFFST 511 T+ E+A+ ++ A +VFGF ++ Sbjct: 211 TTKEEAERVLSAEPKLVFGFLNS 233 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = +3 Query: 99 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 E++V VL+K NF + + +VEFYAPWCG C++L P Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTP 136 Score = 44.4 bits (100), Expect = 7e-05 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 3/68 (4%) Frame = +3 Query: 21 DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWC 191 +NI+ F A L D +P + +V V+ NF E V+ ++ +L+E YAPWC Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467 Query: 192 GHCKSLAP 215 GHC+S P Sbjct: 468 GHCQSFEP 475 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 72.5 bits (170), Expect = 2e-13 Identities = 28/82 (34%), Positives = 49/82 (59%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 439 + +AK+D + +A ++G+PTL F NG+ + Y+GG A+DI+ W++KKTG P + Sbjct: 130 VLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPIIT 189 Query: 440 VTSAEQAKELIDANTVIVFGFF 505 + + ++A +D V G F Sbjct: 190 LNTVDEAPRFLDKYHTFVLGLF 211 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 108 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 VL L+ + VI E+++V YAPWC L P Sbjct: 79 VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMP 114 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 62.1 bits (144), Expect = 3e-10 Identities = 23/82 (28%), Positives = 48/82 (58%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 439 + +AK+D + +A ++G+PTL F NG+ Y+GG +++I+ W++KKTG ++ Sbjct: 128 VLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGASTIK 187 Query: 440 VTSAEQAKELIDANTVIVFGFF 505 + + ++A + + + G F Sbjct: 188 LDTVDEASGFLKKHHTFILGLF 209 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 108 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 V+ L+ N + +I EY++V YAPWC L P Sbjct: 77 VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMP 112 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 57.6 bits (133), Expect = 7e-09 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = +3 Query: 102 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAP 215 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAP 179 Score = 56.8 bits (131), Expect = 1e-08 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 424 + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +3 Query: 45 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAP Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAP 60 Score = 48.0 bits (109), Expect = 6e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 424 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 57.6 bits (133), Expect = 7e-09 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = +3 Query: 102 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAP 215 +NV+VL+ NF E V+ + +LVEFYAPWCGHCKSLAP Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAP 179 Score = 56.8 bits (131), Expect = 1e-08 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 424 + +A +DA + L E YGV G+PTLKFF N + DY GGR DD +S++ +K+G Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +3 Query: 45 IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 I+ ALL L L V ++V+VL+ +FE + + LVEFYAPWCGHCK LAP Sbjct: 6 IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAP 60 Score = 48.0 bits (109), Expect = 6e-06 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 424 + +AKVD +++ + YGV GYPT+++F GS P Y G R A+ + ++ K+ G Sbjct: 75 VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 56.0 bits (129), Expect = 2e-08 Identities = 22/44 (50%), Positives = 31/44 (70%) Frame = +3 Query: 84 DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 D+ + VL L+ +NF++ I+T + I V+FYAPWCGHCK L P Sbjct: 26 DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNP 69 Score = 54.4 bits (125), Expect = 7e-08 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%) Frame = +2 Query: 251 RTPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPP 430 + PI +AK++A + LA + +PTL + +G P++Y G R+AD ++ +LKK P Sbjct: 82 KQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPD 141 Query: 431 AVEVTSAEQAKELI-DANT 484 + S KE + DA T Sbjct: 142 VAVLESDSTVKEFVEDAGT 160 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +2 Query: 266 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 418 +A +DA Q A+ YG++G+PT+K F G +PIDY G R A I ++ K+ Sbjct: 83 VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134 Score = 48.8 bits (111), Expect = 3e-06 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = +3 Query: 108 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 215 V+ L+ +NF++ V+ + +LVEF+APWCGHCK+L P Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTP 68 Score = 48.4 bits (110), Expect = 5e-06 Identities = 20/34 (58%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Frame = +3 Query: 117 LSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 215 L+ +NF+ VI + E +VEF+APWCGHCK LAP Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAP 200 Score = 35.5 bits (78), Expect = 0.034 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKK--KTGP 427 +KL V+ EQ + + V+G+PT+ F SP Y G R A I S+ + ++ Sbjct: 213 VKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVESSA 272 Query: 428 PAVEVT 445 VEVT Sbjct: 273 GPVEVT 278 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = +3 Query: 108 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 215 VL L+ +NF++ V+ + +LVEF+APWCGHC+SL P Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTP 66 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/34 (52%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 117 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAP 215 L+ +NF+ ++T ++ + +VEF+APWCGHCK LAP Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAP 201 Score = 47.6 bits (108), Expect = 8e-06 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +2 Query: 266 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 418 +A +DA + +++ YGVRG+PT+K F G PIDY G R A I + K+ Sbjct: 81 VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132 Score = 38.7 bits (86), Expect = 0.004 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 7/88 (7%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISW----LKKKT 421 +KL V+ EQ + + V+G+PT+ F + SP+ Y G R A I S+ L+ Sbjct: 214 VKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLESNA 273 Query: 422 GPPAV-EVTSAEQAKELIDANTVIVFGF 502 GP V E+T + ++ + + F Sbjct: 274 GPAEVTELTGPDVMEDKCGSAAICFVSF 301 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +2 Query: 266 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 364 LAKVD TQE DL ++GYP+++ FR GS + Sbjct: 201 LAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +3 Query: 81 GDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 GDE E E+ + L+ NF+T ++V FYAPWC C L P Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKP 178 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = +3 Query: 24 NIEMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVITTTEYILVEFYAPWCGH 197 +I RV T IA L L + + ++ L S +E ++ + +VEFYA WC Sbjct: 93 DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152 Query: 198 CKSLAP 215 C+ LAP Sbjct: 153 CRELAP 158 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +3 Query: 96 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 215 T ++ V++ + +++ V+ T ++V+F+APWCG CK + P Sbjct: 78 TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +3 Query: 117 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 215 LS + ++T + ++ +LVEF+APWCG C+ + P Sbjct: 91 LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 263 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 367 K K++ + + A YG+R PT+ F+ G D Sbjct: 138 KFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +2 Query: 272 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 424 KVD + Q +A+ +GV PT F + G +D G +D+ + + K TG Sbjct: 65 KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 36.7 bits (81), Expect = 0.015 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 409 + L VD T+E L +S ++GYP+++ FR GS + Y G R D ++ + Sbjct: 200 VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMV 259 Query: 410 KKKTGP 427 ++ P Sbjct: 260 EELLKP 265 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 117 LSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 L+ A FE + ++V FYAPWC L P Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKP 179 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 36.3 bits (80), Expect = 0.020 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +3 Query: 96 TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 215 T + V++ + +++ V+ E + V+F+APWCG CK + P Sbjct: 72 TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDP 112 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +2 Query: 263 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIIS 403 K K++ + YGVR PT+ F NG D G + D ++ Sbjct: 126 KFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAVSKDTLA 172 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 35.9 bits (79), Expect = 0.026 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +2 Query: 272 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 451 +V+A + +++E+Y V P FF++G +D G AD S L K G A TSA Sbjct: 57 RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSSTSA 112 Query: 452 EQA 460 E A Sbjct: 113 EPA 115 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 35.9 bits (79), Expect = 0.026 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +3 Query: 99 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAP 215 ++ + L+ NF++V+ T +Y +VEF+A WC C++ P Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKP 74 >At1g34780.1 68414.m04329 protein disulfide isomerase-related contains weak similarity to Pfam:P08003 protein disulfide isomerase A4 precursor (Protein ERp-72, ERp72) [Mus musculus] Length = 310 Score = 35.9 bits (79), Expect = 0.026 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 311 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 460 YGV G+PTL + Y G R D ++++ TG ++ TS E++ Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS 180 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 35.5 bits (78), Expect = 0.034 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 10/66 (15%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 409 + L VD T+E L + ++GYP+++ FR GS + Y G R D I+ + Sbjct: 199 VLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMV 258 Query: 410 KKKTGP 427 + P Sbjct: 259 EGLVAP 264 Score = 31.1 bits (67), Expect = 0.73 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +3 Query: 51 TAIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 215 + +AL + G+E E + + L+ A+FE + ++V F APWC L P Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKP 178 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 35.1 bits (77), Expect = 0.045 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 138 TVITTTEYILVEFYAPWCGHCKSLAP 215 TV+ + + +LVEF A WCG CK + P Sbjct: 82 TVLESAQPVLVEFVATWCGPCKLIYP 107 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 35.1 bits (77), Expect = 0.045 Identities = 13/41 (31%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +3 Query: 99 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAP 215 ++N + L+ NF++V + +Y ++EF+A WC C++ P Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKP 80 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 35.1 bits (77), Expect = 0.045 Identities = 13/41 (31%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +3 Query: 99 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAP 215 ++N + L+ NF++V + +Y ++EF+A WC C++ P Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKP 80 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 34.3 bits (75), Expect = 0.079 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +3 Query: 87 EVPTEENVLVLSKANF--ETVITTTEYILV-EFYAPWCGHCKSLAP 215 E T N+L + AN ++++ + ++V +FY+P CG CKSL P Sbjct: 80 EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHP 125 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 34.3 bits (75), Expect = 0.079 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 123 KANFETVITTTEYILVEFYAPWCGHCKSLAP 215 K+ + T + +++EF A WCG CK+L P Sbjct: 49 KSRLNALKDTNKLLVIEFTAKWCGPCKTLEP 79 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = +2 Query: 254 TPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 424 T + K+D + Q +A+ + V PT F + G+ ID G D+I L K G Sbjct: 57 TNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 32.7 bits (71), Expect = 0.24 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 129 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 215 +FE ++ ++ +LV++YA WCG C+ + P Sbjct: 72 SFEDLLVNSDKPVLVDYYATWCGPCQFMVP 101 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 400 I++ K+D + +A Y + PT F++G P D + G A +I Sbjct: 114 IQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +3 Query: 87 EVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSL 209 E+ NV+ LSK E ++ E LV YAPWC C+++ Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAM 380 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 32.3 bits (70), Expect = 0.32 Identities = 10/31 (32%), Positives = 22/31 (70%) Frame = +3 Query: 123 KANFETVITTTEYILVEFYAPWCGHCKSLAP 215 K+ F+++ + + ++++F A WCG CK++ P Sbjct: 33 KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEP 63 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.3 bits (70), Expect = 0.32 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 +LV+FYA WCG C+ + P Sbjct: 79 VLVDFYATWCGPCQLMVP 96 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 400 I + K+D + LA Y + PT F++G D + G A+ ++ Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQLV 156 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 31.1 bits (67), Expect = 0.73 Identities = 20/60 (33%), Positives = 31/60 (51%) Frame = +2 Query: 272 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 451 +V+A + +++E+Y V P FF++G +D G AD S L K G A +T A Sbjct: 57 RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSITPA 112 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 31.1 bits (67), Expect = 0.73 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 ++V+FY WCG C+++ P Sbjct: 116 VIVDFYGTWCGSCRAMFP 133 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +2 Query: 404 WLKKKTGPPAVEVTSAEQ-AKELIDA-NTVIVFGFFST 511 W ++K GP +++TSAEQ L DA + +++ F+ T Sbjct: 86 WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDFYGT 123 >At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS reductase homolog (PRH26) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738760; identical to cDNA PAPS reductase homolog (PRH26) GI:1710113 Length = 458 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +3 Query: 69 GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSL 209 G A ++ ENV+ LS+ E ++ E +V YAPWC C+++ Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAM 384 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +2 Query: 272 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 415 KVD + + +A + ++ PT F + G +D G + D++ S + K Sbjct: 64 KVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 ++V+F A WCG C+ +AP Sbjct: 31 VVVDFTASWCGPCRFIAP 48 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 31.1 bits (67), Expect = 0.73 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 135 ETVITTTEYILVEFYAPWCGHCK 203 ++V+ + +LVEFY WCG C+ Sbjct: 78 DSVLKSETPVLVEFYTSWCGPCR 100 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 30.7 bits (66), Expect = 0.97 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 ++VEFY WC C++L P Sbjct: 126 VIVEFYGTWCASCRALFP 143 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 30.7 bits (66), Expect = 0.97 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 ++VEFY WC C++L P Sbjct: 126 VIVEFYGTWCASCRALFP 143 >At4g08930.1 68417.m01470 thioredoxin-related contains weak similarity to Swiss-Prot:Q39239 thioredoxin H-type 4 (TRX-H-4). [Mouse-ear cress] Length = 295 Score = 30.7 bits (66), Expect = 0.97 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 311 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 424 YGV G+PT+ + + Y G R D ++++ TG Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 272 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID 367 KVD + D+A S+ + PT F R+G +D Sbjct: 328 KVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 29.9 bits (64), Expect = 1.7 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 129 NFETVITTTEYILVEFYAPWCGHCKSLAP 215 +F + + + ++V+F A WCG C+ + P Sbjct: 39 HFNEIKESNKLLVVDFSASWCGPCRMIEP 67 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 114 VLSKANFETVITTTEYILVEFYAPWCGHCKSL 209 +L++ NF + I ++L+ PWCG +SL Sbjct: 29 ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSL 60 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 436 I++ +VD + + + YPT F NG + Y G R + + +++ ++T A Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136 Query: 437 EVTSAEQAKEL 469 E E KEL Sbjct: 137 EKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 108 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 209 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 436 I++ +VD + + + YPT F NG + Y G R + + +++ ++T A Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136 Query: 437 EVTSAEQAKEL 469 E E KEL Sbjct: 137 EKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 108 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 209 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Frame = +2 Query: 260 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 436 I++ +VD + + + YPT F NG + Y G R + + +++ ++T A Sbjct: 78 IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136 Query: 437 EVTSAEQAKEL 469 E E KEL Sbjct: 137 EKAQLED-KEL 146 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 108 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 209 V+ L+ F I + V+F PWC HCK L Sbjct: 27 VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +3 Query: 102 ENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSL 209 EN++ LS+ E ++ E +V YAPWC C+++ Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAM 391 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 29.1 bits (62), Expect = 3.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 ++++ Y WCG CK +AP Sbjct: 100 VVLDMYTQWCGPCKVIAP 117 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 29.1 bits (62), Expect = 3.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 ++++ Y WCG CK +AP Sbjct: 90 VVLDMYTQWCGPCKVIAP 107 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 153 TEYILVEFYAPWCGHCKSLAP 215 T +++V F A WCG C+ + P Sbjct: 227 TPHVMVMFTARWCGPCRDMIP 247 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 ++V+F++P CG CK+L P Sbjct: 120 VVVDFFSPGCGGCKALHP 137 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 272 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 415 KVD + +AE + V+ PT F + G + G ++II+ L+K Sbjct: 63 KVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 28.7 bits (61), Expect = 3.9 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 ++V+F++P CG CK+L P Sbjct: 116 VVVDFFSPSCGGCKALHP 133 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 28.3 bits (60), Expect = 5.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLA 212 ++V+FYA WCG C +A Sbjct: 97 LIVDFYATWCGPCILMA 113 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 275 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 397 VD + +++A V+ PT F ++G+ +D G D+I Sbjct: 61 VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 474 SISSLACSAEVTSTAGGPVFFFSQLMMSSA*RPP 373 S ++ AC +S+ GGP +++ S + RPP Sbjct: 60 SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 27.9 bits (59), Expect = 6.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 162 ILVEFYAPWCGHCKSLAP 215 ++ F A WCG CK +AP Sbjct: 48 VVANFSATWCGPCKIVAP 65 >At1g16230.1 68414.m01944 syntaxin-related family protein similar to syntaxin of plants 51 [Arabidopsis thaliana] GI:13811644, syntaxin of plants 52 [Arabidopsis thaliana] GI:13811646 Length = 193 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -3 Query: 696 RSSVISSSSYLTRFSSKVLEKHNIFIFSLQLLDHFLIADNSKYLVINNLSS*KESF 529 RSS+ +SSY R +S + K I +Q L + L K + +S K +F Sbjct: 29 RSSLAETSSYALRHASSMRRKITILATRVQTLKYLLAESQGKSISGKEMSRRKGTF 84 >At4g08710.1 68417.m01439 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 715 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 538 LSTAQVVDDQVFAIVSDEKVIKELEAEDEDV 630 L T QV+D V + ++K++K + E++DV Sbjct: 470 LGTTQVIDSIVTLGIEEQKLMKAITEEEDDV 500 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 275 VDATQEQDLAESYGVRGYPTLKFFRNGSPI 364 VD + LA++ +R PT K ++NG + Sbjct: 642 VDVEESMALAKAESIRKVPTFKMYKNGDKV 671 >At2g34680.1 68415.m04260 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560; identical to cDNA hypothetical protein (AIR9) mRNA, partial cds GI:3695020 Length = 1661 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/61 (22%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +2 Query: 365 DYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELI---DANTVIVFGFFSTRAQPEPKL 535 DY GG++ WL+K + + SA ++ + D T + F + + PK+ Sbjct: 683 DYFGGKEGPSKFEWLRKNKETGELSLISAGTSEYTLTQEDVGTHVTFVYIPANFEAPPKV 742 Query: 536 S 538 + Sbjct: 743 T 743 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 248 RRTPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 364 R I KVD + + + VR PT+K ++NGS + Sbjct: 641 RYPSIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRV 679 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,702,558 Number of Sequences: 28952 Number of extensions: 265878 Number of successful extensions: 893 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -