BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30933.Seq (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0553 + 23185473-23186188,23187096-23187101,23187230-231873... 28 8.2 >01_05_0553 + 23185473-23186188,23187096-23187101,23187230-23187374, 23187887-23188159,23188275-23188338,23188479-23188744, 23188951-23189045,23189544-23189718,23190669-23191063, 23191830-23191953,23192864-23192959,23193049-23193120, 23194687-23194824,23195369-23195549,23195602-23195963, 23196944-23197386,23197461-23197763,23197857-23198081, 23198260-23198350,23198702-23198779,23198939-23199229, 23199316-23199513,23199681-23200163,23200488-23200562, 23201163-23201324,23201400-23201729,23201816-23201916, 23202477-23202581,23202931-23203162,23203913-23204257, 23204346-23204447,23206010-23206153,23206463-23206551, 23206979-23207061,23207172-23207287,23207824-23207909, 23208461-23208560,23209270-23209335 Length = 2451 Score = 27.9 bits (59), Expect = 8.2 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +1 Query: 319 INNIFSSSFSTGWDLKSITCDVNRYEFEALISF-LEPQGPMFRLCYRLLSDTQLKYELPL 495 I +I S ST L+S CD + E ISF + +GP + RL+++ +L L L Sbjct: 1239 IEDIVISGKSTSNSLESPKCDEAKLEPTTFISFDWDNEGPYEKAVERLINEGKLTDALAL 1298 Query: 496 N 498 + Sbjct: 1299 S 1299 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,097,662 Number of Sequences: 37544 Number of extensions: 269665 Number of successful extensions: 433 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -