BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30933.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22238| Best HMM Match : CMAS (HMM E-Value=3.5e-15) 30 1.6 SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) 30 2.1 SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073) 29 2.7 SB_52976| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_34635| Best HMM Match : PE (HMM E-Value=0.82) 29 4.8 >SB_22238| Best HMM Match : CMAS (HMM E-Value=3.5e-15) Length = 1605 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -1 Query: 392 YRLTSHVILFKSHPVLNEEEKMLFIN*GNIVCRSLVELDWSIILVN 255 Y L + +LF+S P+ EK ++ + N+ C + E DW + ++ Sbjct: 301 YDLNTKELLFQSAPMYQYLEKKMYRDAYNVACLGVTEGDWRALALD 346 >SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) Length = 900 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/63 (26%), Positives = 31/63 (49%) Frame = +1 Query: 127 YENKSLEYIFNHQTKLNK*NNGSRFDESVLYKSEFAFTRESH*LTRIIDQSSSTKDLQTI 306 + ++ LE+ F KL NN + +++++ K + L RIID S K+ + Sbjct: 19 FGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVYCHKAVIEELKRIIDDSEVMKEDDAL 78 Query: 307 FPQ 315 +PQ Sbjct: 79 WPQ 81 >SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073) Length = 1387 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = +1 Query: 265 IIDQSSSTKDLQTIFPQLINNIFSSSFSTGWDLKSITCDVNRYEFEALISFLEP 426 I+D +++KD++ + QL+N FS+ L SIT R AL+ F P Sbjct: 1204 ILDDCAASKDVKRRYDQLVNLAFSARHVITQQLTSITKPF-RENIAALVFFYTP 1256 >SB_52976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = -1 Query: 458 NL*HSRNIGP*GSKKLIRASNSYRLTSHVILFKS 357 +L HSRN+ SK L R+++ YRL+SH IL S Sbjct: 50 DLYHSRNLYR--SKDLYRSNDLYRLSSHEILADS 81 >SB_34635| Best HMM Match : PE (HMM E-Value=0.82) Length = 436 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 480 VRIAIKCITSDLQVTLERGRCPQFYADMLTADAQ 581 ++ ++ T+DLQ ERG C +Y L D Q Sbjct: 19 IQALVRASTADLQSLGERGNCNHYYNPTLKVDQQ 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,428,154 Number of Sequences: 59808 Number of extensions: 353886 Number of successful extensions: 737 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -