BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30929.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding pr... 25 1.7 AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-b... 25 1.7 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 2.3 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 24 5.3 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 9.2 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 9.2 >AY146737-1|AAO12097.1| 119|Anopheles gambiae odorant-binding protein AgamOBP27 protein. Length = 119 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/44 (22%), Positives = 21/44 (47%) Frame = +1 Query: 151 NRDGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCV 282 NRD ++F + +++ + + + +V PT C F C+ Sbjct: 64 NRDTIMRFTNRFVSKEISEKVYNICTDNVTPTYCVTAFDVYQCI 107 >AJ697722-1|CAG26915.1| 119|Anopheles gambiae putative odorant-binding protein OBPjj12 protein. Length = 119 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/44 (22%), Positives = 21/44 (47%) Frame = +1 Query: 151 NRDGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCV 282 NRD ++F + +++ + + + +V PT C F C+ Sbjct: 64 NRDTIMRFTNRFVSKEISEKVYNICTDNVTPTYCVTAFDVYQCI 107 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.0 bits (52), Expect = 2.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 680 VFHRKPSVFTIEIKLESISED 618 V HR+PS ++E+ ES+ D Sbjct: 637 VIHRRPSTSSVELSEESMDSD 657 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = -1 Query: 461 LI*PTLGLMMSSLFFKASWNVILPPIAS 378 L+ L +++++++FK SW++ P A+ Sbjct: 187 LLQDALMMLINTIYFKGSWSIPFPTNAT 214 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 9.2 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = -1 Query: 362 TSSPFPQ---NLASSSMPSSCMTVESTSKQTQSAVLNNS 255 TS+P P ++AS S SS MT +T+ +V + S Sbjct: 266 TSAPSPATYGDIASPSSASSAMTTPATTSSPTGSVYDYS 304 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 9.2 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = -1 Query: 362 TSSPFPQ---NLASSSMPSSCMTVESTSKQTQSAVLNNS 255 TS+P P ++AS S SS MT +T+ +V + S Sbjct: 266 TSAPSPATYGDIASPSSASSAMTTPATTSSPTGSVYDYS 304 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 674,038 Number of Sequences: 2352 Number of extensions: 14302 Number of successful extensions: 23 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -