BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30928.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 5e-29 SB_56255| Best HMM Match : Arf (HMM E-Value=0) 122 2e-28 SB_11310| Best HMM Match : Arf (HMM E-Value=0) 112 2e-25 SB_53421| Best HMM Match : Arf (HMM E-Value=0) 108 5e-24 SB_56254| Best HMM Match : Arf (HMM E-Value=5.3e-31) 98 7e-21 SB_57342| Best HMM Match : Arf (HMM E-Value=0) 97 2e-20 SB_32972| Best HMM Match : Arf (HMM E-Value=2.66247e-44) 90 2e-18 SB_37042| Best HMM Match : Arf (HMM E-Value=0) 85 4e-17 SB_18358| Best HMM Match : Arf (HMM E-Value=0) 83 2e-16 SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) 75 6e-14 SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_7588| Best HMM Match : DcpS (HMM E-Value=0) 60 2e-09 SB_214| Best HMM Match : Arf (HMM E-Value=0) 57 1e-08 SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) 57 2e-08 SB_51371| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) 45 7e-05 SB_8302| Best HMM Match : G-alpha (HMM E-Value=0) 43 2e-04 SB_977| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_49453| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_31701| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_27557| Best HMM Match : Ras (HMM E-Value=0) 37 0.014 SB_44625| Best HMM Match : Ras (HMM E-Value=0) 37 0.018 SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_4971| Best HMM Match : Ras (HMM E-Value=0) 36 0.032 SB_10811| Best HMM Match : Ras (HMM E-Value=0) 36 0.032 SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_50855| Best HMM Match : Ras (HMM E-Value=0) 32 0.39 SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) 31 1.2 SB_13045| Best HMM Match : Ras (HMM E-Value=0) 30 2.1 SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) 30 2.1 SB_50523| Best HMM Match : Ras (HMM E-Value=0) 29 3.6 SB_19345| Best HMM Match : Arf (HMM E-Value=3.3e-05) 29 3.6 SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) 29 3.6 SB_28309| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_40811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 124 bits (300), Expect = 5e-29 Identities = 56/88 (63%), Positives = 69/88 (78%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +IYVVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVESVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DR+R+ SK+EL ML+E+EL +A L Sbjct: 95 NDRERVNESKEELNKMLQEDELKDAVVL 122 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +3 Query: 171 SYFRGLLGAREMRILILGLDGAGKTTILINCK 266 S F L G ++MRIL++GLD AGKTTIL K Sbjct: 7 SLFTRLFGKKQMRILMVGLDAAGKTTILYKLK 38 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = +1 Query: 496 ISERXLVVLANKQDMAGCLT*PRYTQALGLXTPCAIEXSQIL*DFSRXKAXGLDSGRMDW 675 + + ++V+ANKQD+ L+ T+ LGL + + + + GL G +DW Sbjct: 116 LKDAVVLVMANKQDLPNALSVSEITEKLGLQS--IRDRQWYIQAACATQGTGLYEG-LDW 172 Query: 676 LSKRAFK 696 LS K Sbjct: 173 LSNELSK 179 >SB_56255| Best HMM Match : Arf (HMM E-Value=0) Length = 181 Score = 122 bits (295), Expect = 2e-28 Identities = 54/88 (61%), Positives = 69/88 (78%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +I+VVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DR+R+G +++EL ML E+EL +A L Sbjct: 95 NDRERVGEAREELNRMLNEDELRDAVLL 122 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +3 Query: 156 MGGLFS-YFRGLLGAREMRILILGLDGAGKTTILINCK 266 MGG+F+ F GL G +EMRIL++GLD AGKTTIL K Sbjct: 1 MGGMFAKLFAGLFGKKEMRILMVGLDAAGKTTILYKLK 38 >SB_11310| Best HMM Match : Arf (HMM E-Value=0) Length = 255 Score = 112 bits (270), Expect = 2e-25 Identities = 54/98 (55%), Positives = 66/98 (67%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 Y L++ E V TIPTIGFNVE V YKN+KF VWD+GGQ IR WR Y+ T +I+VVDS Sbjct: 108 YHLKLDEPVNTIPTIGFNVEVVEYKNIKFTVWDIGGQDKIRLLWRLYFQETQGLIFVVDS 167 Query: 434 ADRDRIGISKDELVHMLREEELANAXSLF*PTNRTWPD 547 DRDRI +K+EL +L+EEEL A L + PD Sbjct: 168 NDRDRIQEAKEELFKLLKEEELKRAALLVLANKQDLPD 205 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/40 (57%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +3 Query: 150 NKMGG-LFSYFRGLLGAREMRILILGLDGAGKTTILINCK 266 +KMG + S FR LLG E+R+L++GLD AGKTTIL + K Sbjct: 72 SKMGNSVLSLFRRLLGKDELRLLMVGLDAAGKTTILYHLK 111 >SB_53421| Best HMM Match : Arf (HMM E-Value=0) Length = 625 Score = 108 bits (259), Expect = 5e-24 Identities = 48/82 (58%), Positives = 62/82 (75%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 Y+L++ EVV+T+PT+GFNVE VTYKN+ F VWD+GGQ IR WR YY II+VVDS Sbjct: 14 YRLKLEEVVSTVPTLGFNVETVTYKNISFTVWDIGGQDKIRALWRVYYQGCQGIIFVVDS 73 Query: 434 ADRDRIGISKDELVHMLREEEL 499 ADR+R +++EL +L EEEL Sbjct: 74 ADRERAEEARNELHKLLAEEEL 95 >SB_56254| Best HMM Match : Arf (HMM E-Value=5.3e-31) Length = 650 Score = 97.9 bits (233), Expect = 7e-21 Identities = 48/96 (50%), Positives = 62/96 (64%) Frame = +2 Query: 230 RCRKDDNSYKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTD 409 R R + K + +V+ P GFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT Sbjct: 478 RSRYKGSRQKTHIQAMVS--PVQGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQ 535 Query: 410 AIIYVVDSADRDRIGISKDELVHMLREEELANAXSL 517 +I+VVDS DR+R G +K+EL ML E+EL +A L Sbjct: 536 GLIFVVDSNDRERAGEAKEELSRMLAEDELRDAVLL 571 >SB_57342| Best HMM Match : Arf (HMM E-Value=0) Length = 457 Score = 96.7 bits (230), Expect = 2e-20 Identities = 47/103 (45%), Positives = 65/103 (63%), Gaps = 1/103 (0%) Frame = +2 Query: 194 CKGNADFDTWIGRCRKDDNSYKLQVGEVVTTIPTIGFNVEQVT-YKNLKFQVWDLGGQTS 370 C A + GR RK YKL++ E V T+PT+ FNVE ++ KN+ F VWD+GGQ Sbjct: 107 CVVPAKYSLRSGRGRKTTILYKLKLKETVNTVPTVAFNVETISPCKNITFSVWDIGGQDK 166 Query: 371 IRPYWRCYYGNTDAIIYVVDSADRDRIGISKDELVHMLREEEL 499 IR WR Y+ + II+VVDSAD++RI ++EL +L+ EL Sbjct: 167 IRRLWRHYFQGAEGIIFVVDSADKERIFEVREELTRVLQHSEL 209 >SB_32972| Best HMM Match : Arf (HMM E-Value=2.66247e-44) Length = 257 Score = 89.8 bits (213), Expect = 2e-18 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +2 Query: 359 GQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDELVHMLREEELANA 508 GQTSIRPYWRCYY NTDA+IYVVDS D+DRIGISK EL+ ML E+EL A Sbjct: 155 GQTSIRPYWRCYYANTDAVIYVVDSVDKDRIGISKQELLAMLEEDELKKA 204 Score = 31.5 bits (68), Expect = 0.68 Identities = 21/67 (31%), Positives = 32/67 (47%) Frame = +1 Query: 475 AYVKGRRISERXLVVLANKQDMAGCLT*PRYTQALGLXTPCAIEXSQIL*DFSRXKAXGL 654 A ++ + + L+V ANKQDM G ++ + ALGL + + S K GL Sbjct: 194 AMLEEDELKKAILIVFANKQDMEGAMSSSEVSNALGL--SALKSRTWAIFKTSAVKGEGL 251 Query: 655 DSGRMDW 675 D M+W Sbjct: 252 DEA-MEW 257 >SB_37042| Best HMM Match : Arf (HMM E-Value=0) Length = 188 Score = 85.4 bits (202), Expect = 4e-17 Identities = 40/82 (48%), Positives = 58/82 (70%), Gaps = 1/82 (1%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVT-YKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 YKL++ E V+TIPTIGFNVE + KN+ +WD+GGQ IRP WR Y+ T+ +++VVD Sbjct: 37 YKLKLKETVSTIPTIGFNVETLQPTKNVTLTIWDVGGQDKIRPLWRHYFQGTEGLLFVVD 96 Query: 431 SADRDRIGISKDELVHMLREEE 496 S+D R+ +K+EL +L +E Sbjct: 97 SSDVLRMPEAKEELHGVLDSDE 118 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/41 (53%), Positives = 29/41 (70%) Frame = +3 Query: 144 LINKMGGLFSYFRGLLGAREMRILILGLDGAGKTTILINCK 266 L++K+ LFS F G R++RI++LGLD AGKTTIL K Sbjct: 4 LLSKVITLFSEF----GNRQVRIVMLGLDAAGKTTILYKLK 40 >SB_18358| Best HMM Match : Arf (HMM E-Value=0) Length = 214 Score = 83.4 bits (197), Expect = 2e-16 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 1/99 (1%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVT-YKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 Y+ + E V T+PT FNVE + +K ++F+VWD+GG+ RP W+ Y TDA+IYVVD Sbjct: 39 YRNKFREYVNTVPTTAFNVETIRPFKGIRFKVWDIGGREQNRPLWKAYARQTDAVIYVVD 98 Query: 431 SADRDRIGISKDELVHMLREEELANAXSLF*PTNRTWPD 547 S ++ ++DEL ++L +L A L + P+ Sbjct: 99 STSAGKLEEARDELFNLLNSAQLNGAPILIFANKQDCPN 137 >SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36) Length = 260 Score = 74.9 bits (176), Expect = 6e-14 Identities = 31/72 (43%), Positives = 49/72 (68%) Frame = +2 Query: 287 IPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKD 466 IPT+GFN+ +V+ N+ +VWD+GGQ R W Y + I+Y+VD+AD D++ SK+ Sbjct: 50 IPTVGFNMRKVSKGNVTIKVWDIGGQPRFRSMWERYCRGVNCIVYMVDAADHDKLEASKN 109 Query: 467 ELVHMLREEELA 502 EL ++L + +LA Sbjct: 110 ELHNLLEKPQLA 121 >SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 64.5 bits (150), Expect = 8e-11 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +2 Query: 335 KFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDELVHMLREE 493 K +WD+GGQ S+R YWR Y+ +TD +I+VVDSAD+ R+ K EL +L EE Sbjct: 3 KLNIWDVGGQRSLRSYWRNYFESTDGLIWVVDSADQRRLADCKMELQGLLVEE 55 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 62.1 bits (144), Expect = 4e-10 Identities = 27/68 (39%), Positives = 39/68 (57%) Frame = +2 Query: 281 TTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGIS 460 +T T GFNV +T L +W++GG R YW + +T ++YVVDS+D DR S Sbjct: 196 STTKTEGFNVVCLTTDGLNLNIWEIGGDEKYRAYWPNFIADTQLLVYVVDSSDPDRFNES 255 Query: 461 KDELVHML 484 +D L +L Sbjct: 256 RDNLKSLL 263 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 201 EMRILILGLDGAGKTTIL 254 E RIL+LGLDG+GK+ L Sbjct: 166 EKRILVLGLDGSGKSVFL 183 >SB_7588| Best HMM Match : DcpS (HMM E-Value=0) Length = 446 Score = 59.7 bits (138), Expect = 2e-09 Identities = 26/66 (39%), Positives = 39/66 (59%) Frame = +2 Query: 350 DLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDELVHMLREEELANAXSLF*PT 529 D+GGQ IRP WR Y+ + +I+VVD ADRDRI ++ EL ++ + E+ + L Sbjct: 143 DVGGQDKIRPLWRHYFAGSQGLIFVVDCADRDRIDEARKELQRIINDREMKDVIILIFAN 202 Query: 530 NRTWPD 547 + PD Sbjct: 203 KQDLPD 208 >SB_214| Best HMM Match : Arf (HMM E-Value=0) Length = 148 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/77 (31%), Positives = 46/77 (59%) Frame = +2 Query: 287 IPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKD 466 +PT+ E+++ ++F +DLGG R W+ Y+ + I++++D AD +R+ SK Sbjct: 5 VPTLHPTSEELSMGGMRFTTFDLGGHRQARRIWKDYFPAVNGIVFIIDCADFERLAESKK 64 Query: 467 ELVHMLREEELANAXSL 517 EL +L +E+L++ L Sbjct: 65 ELDSLLADEQLSSCPVL 81 >SB_15207| Best HMM Match : Arf (HMM E-Value=1.9e-05) Length = 259 Score = 56.8 bits (131), Expect = 2e-08 Identities = 23/50 (46%), Positives = 33/50 (66%) Frame = +2 Query: 257 KLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNT 406 K+++ V + GFNVE V +++LKF +WD+GG +RP WR YY NT Sbjct: 208 KMEMRAVALGLDGAGFNVETVEHRSLKFTIWDVGGLQKLRPLWRHYYLNT 257 >SB_51371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1325 Score = 56.0 bits (129), Expect = 3e-08 Identities = 23/49 (46%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = +2 Query: 272 EVVTTIPTIGFNVEQVTYKN-LKFQVWDLGGQTSIRPYWRCYYGNTDAI 415 +V+ PT GFN++ V K + VWD+GGQ IRPYW+ Y+ NTD + Sbjct: 41 DVLHITPTQGFNIKSVQSKGGFRLNVWDIGGQRKIRPYWKNYFENTDIL 89 Score = 37.9 bits (84), Expect = 0.008 Identities = 21/33 (63%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +3 Query: 162 GLFSYFRGLLGA--REMRILILGLDGAGKTTIL 254 GL S R L REMRIL+LGLD +GKTTIL Sbjct: 2 GLLSLLRKLKSEKDREMRILLLGLDNSGKTTIL 34 >SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) Length = 334 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/75 (30%), Positives = 45/75 (60%) Frame = +2 Query: 326 KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDELVHMLREEELAN 505 KN+ F VWD+GGQ ++R ++ + + +IYVVDS D R +++ +L+ +L+E+ + + Sbjct: 16 KNVHFAVWDIGGQPNLRKHY--FTDDKSGLIYVVDSTDIQR--LNEAQLLGILQEKVMVD 71 Query: 506 AXSLF*PTNRTWPDV 550 + + P+V Sbjct: 72 VPVVVVANKQDLPNV 86 >SB_8302| Best HMM Match : G-alpha (HMM E-Value=0) Length = 315 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/70 (34%), Positives = 37/70 (52%) Frame = +2 Query: 281 TTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGIS 460 T + T G Q YK L F+++D+GGQ S R W + + AIIY V + D + + Sbjct: 178 TRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCVALSAYD-LSLE 236 Query: 461 KDELVHMLRE 490 +DE + + E Sbjct: 237 EDESTNRMEE 246 >SB_977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = +2 Query: 281 TTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYW-RCYYGNTDAIIYVVDSADRDRIGI 457 T + T G T+K+L F+++D+GGQ S R W C+ G T AII+ V + D + Sbjct: 177 TRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVT-AIIFCVALSAYDLVLA 235 Query: 458 SKDELVHMLREEEL 499 +E+ M+ +L Sbjct: 236 EDEEMNRMMESMKL 249 >SB_49453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1117 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/70 (34%), Positives = 37/70 (52%) Frame = +2 Query: 281 TTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGIS 460 T + T G Q YK L F+++D+GGQ S R W + + AIIY V + D + + Sbjct: 226 TRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCVALSAYD-LTLE 284 Query: 461 KDELVHMLRE 490 +DE + + E Sbjct: 285 EDESTNRMEE 294 >SB_31701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 272 EVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYW 385 E +TT T+G N+ ++T ++K WDLGGQ +R W Sbjct: 55 EKITT--TVGLNIGKITISHVKLMFWDLGGQQELRTLW 90 Score = 32.3 bits (70), Expect = 0.39 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +3 Query: 141 KLINKMGGLFSYFRGLLGAREMRILILGLDGAGKTTILINCK 266 ++ + GL+ Y L E ILILGLD AGKTT+L K Sbjct: 4 EMFTLLSGLWKY---LFQKDEYFILILGLDNAGKTTLLEQIK 42 >SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 296 IGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 +G V + +K Q WD GQ R + YY N DA+I V D +R Sbjct: 48 VGTRVLDIHGDRVKLQCWDTAGQEKFRGITQSYYRNADAVILVFDITNR 96 >SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = +2 Query: 290 PTIG--FNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 PTIG F ++ V + +K Q+WD GQ R + YY N D +I D ++ Sbjct: 38 PTIGVDFTIKTVDVDGEKVKLQIWDTAGQERFRSITQSYYHNADGVIVTYDITNK 92 >SB_27557| Best HMM Match : Ras (HMM E-Value=0) Length = 184 Score = 37.1 bits (82), Expect = 0.014 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = +2 Query: 290 PTIG--FNVEQVTYKN---LKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 PT+G F+V + K +K Q+WD GQ R YY NT + + D +RD Sbjct: 44 PTVGVDFHVRVLELKGDVRIKLQIWDTAGQERFRSITYSYYRNTVGCLIIYDITNRD 100 >SB_44625| Best HMM Match : Ras (HMM E-Value=0) Length = 128 Score = 36.7 bits (81), Expect = 0.018 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = +2 Query: 269 GEVVTTIPTIGFNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 G +TTI + F + + + +K Q+WD GQ R YY T +I V D Sbjct: 4 GSYITTIG-VDFKIRTINIDGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSA 62 Query: 443 D 445 D Sbjct: 63 D 63 >SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 35.9 bits (79), Expect = 0.032 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = +2 Query: 287 IPTIG--FNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 I TIG F + + K +K Q+WD GQ R YY II V D D++ Sbjct: 59 ISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQE 115 >SB_4971| Best HMM Match : Ras (HMM E-Value=0) Length = 209 Score = 35.9 bits (79), Expect = 0.032 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +2 Query: 281 TTIPTIG--FNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 T I TIG F + +T K +K Q+WD GQ R YY + I+ + D Sbjct: 36 TYISTIGVDFKIRTLTVDGKTIKLQIWDTAGQERFRTLTTAYYRSAHGIVLIYD 89 >SB_10811| Best HMM Match : Ras (HMM E-Value=0) Length = 304 Score = 35.9 bits (79), Expect = 0.032 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +2 Query: 299 GFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 G + V K++K Q+WD GQ R R YY + V D + R+ Sbjct: 133 GSKIVNVGGKSVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDISSRE 181 >SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 32.7 bits (71), Expect = 0.29 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 332 LKFQVWDLGGQTSIRPYWRC-YYGNTDAIIYVVD 430 +K Q+WD GQ R C YY N +A++++ D Sbjct: 95 VKLQLWDTAGQERFRKSMVCHYYRNVNAVVFMYD 128 >SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 32.7 bits (71), Expect = 0.29 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +2 Query: 296 IGFNVEQVTYKN--LKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDE 469 + F V+ +T + K +WD GQ R YY +I V D+ R+ D+ Sbjct: 43 VDFKVKTLTVEGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDTNSRETF----DK 98 Query: 470 LVHMLREEEL 499 L L E E+ Sbjct: 99 LEEWLNEVEM 108 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +2 Query: 332 LKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDELVHMLRE 490 +KF++WD GQ YY A I V D ++D +K + + R+ Sbjct: 70 VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFARAKTWVKELQRQ 122 >SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) Length = 241 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 326 KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 +++K Q+WD GQ R + YY + + +I D Sbjct: 93 QDVKLQIWDTAGQERFRTITQSYYRSCNGVIIAYD 127 >SB_13045| Best HMM Match : Ras (HMM E-Value=0) Length = 629 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 QV K +K QVWD GQ R YY + V D Sbjct: 55 QVEGKIIKAQVWDTAGQERYRAITSAYYRGAVGAVLVYD 93 >SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) Length = 115 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +2 Query: 296 IGFNVEQV--TYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKD 466 I F V+ V K +K Q+WD GQ R YY I + D + + +D Sbjct: 56 IDFKVKTVFRNDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFQAVQD 114 >SB_50523| Best HMM Match : Ras (HMM E-Value=0) Length = 154 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 326 KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 K +K Q+WD GQ YY I+ V D Sbjct: 3 KKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYD 37 >SB_19345| Best HMM Match : Arf (HMM E-Value=3.3e-05) Length = 222 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 401 NTDAIIYVVD-SADRDRIGISKDELVHMLREEE 496 N DA IYVVD SA+ R+ I EL M+ + Sbjct: 126 NVDAFIYVVDSSAESQRVNIGDKELQAMMNNSK 158 >SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) Length = 421 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +2 Query: 317 VTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 V K KF +WD GQ + YY + A I V D Sbjct: 4 VNDKAYKFNIWDTAGQERFKSLAPLYYRDAAAAILVYD 41 >SB_28309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/53 (28%), Positives = 31/53 (58%), Gaps = 4/53 (7%) Frame = -1 Query: 614 WEXSI--AQGVXSPRAWVYLG-YVRHPAMS-CLLAKTTSXRSLILLPLTYAQV 468 W +I ++G+ P+AWV +G + P +S L++ + S ++ P+TY ++ Sbjct: 350 WSLTIHKSEGITLPKAWVDIGKSEKTPGISYAALSRVKALSSCVIEPMTYQRL 402 >SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Frame = +2 Query: 290 PTIGFNVEQVTYK-----NLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 PTIG + T + ++ Q+W + GQ R YY DA + + D Sbjct: 49 PTIGVDFALKTIQWAQNTTIRLQIWLIAGQERFSSMTRVYYKGADACVVLFD 100 >SB_40811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.9 bits (59), Expect = 8.4 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +2 Query: 185 IAGCKGNADFDTWIGRCRKDDNSYKLQVGEVVTTIPTIGFNVEQVT-YKNLKFQVWDLG 358 +A + N D C K Y++Q G V IPT+ + V Y+NL+ DLG Sbjct: 268 LAAERMNVQKDMLSDYCNKTATKYRIQTGLVPKLIPTLKDKEKYVLHYRNLQLYT-DLG 325 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,611,839 Number of Sequences: 59808 Number of extensions: 446588 Number of successful extensions: 1039 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -