BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30928.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24765.1 68415.m02959 ADP-ribosylation factor 3 (ARF3) identi... 141 5e-34 At5g14670.1 68418.m01719 ADP-ribosylation factor, putative simil... 122 2e-28 At3g62290.1 68416.m06998 ADP-ribosylation factor identical to GP... 122 2e-28 At2g47170.1 68415.m05890 ADP-ribosylation factor 1 (ARF1) identi... 122 2e-28 At1g70490.3 68414.m08112 ADP-ribosylation factor, putative nearl... 122 2e-28 At1g70490.2 68414.m08111 ADP-ribosylation factor, putative nearl... 122 2e-28 At1g70490.1 68414.m08110 ADP-ribosylation factor, putative nearl... 122 2e-28 At1g23490.1 68414.m02948 ADP-ribosylation factor identical to SP... 122 2e-28 At1g10630.1 68414.m01205 ADP-ribosylation factor, putative simil... 122 2e-28 At5g17060.1 68418.m01999 ADP-ribosylation factor, putative simil... 117 9e-27 At3g03120.1 68416.m00308 ADP-ribosylation factor, putative simil... 117 9e-27 At3g22950.1 68416.m02893 ADP-ribosylation factor, putative simil... 111 6e-25 At2g15310.1 68415.m01746 ADP-ribosylation factor, putative simil... 105 3e-23 At2g18390.1 68415.m02142 ADP-ribosylation factor-like protein 2 ... 83 1e-16 At5g37680.1 68418.m04538 ADP-ribosylation factor, putative ADP-r... 77 1e-14 At3g49870.1 68416.m05452 ADP-ribosylation factor, putative simil... 75 6e-14 At5g67560.1 68418.m08519 ADP-ribosylation factor, putative ident... 74 1e-13 At3g49860.1 68416.m05451 ADP-ribosylation factor, putative simil... 70 1e-12 At5g52210.2 68418.m06481 ADP-ribosylation factor, putative simil... 68 5e-12 At5g52210.1 68418.m06480 ADP-ribosylation factor, putative simil... 68 5e-12 At3g62560.1 68416.m07028 GTP-binding protein, putative similar t... 64 6e-11 At1g02440.1 68414.m00192 ADP-ribosylation factor, putative simil... 63 2e-10 At4g02080.1 68417.m00279 GTP-binding protein (SAR1A) identical t... 62 3e-10 At1g56330.1 68414.m06475 GTP-binding protein (SAR1B) identical t... 61 6e-10 At1g02430.1 68414.m00190 ADP-ribosylation factor, putative simil... 61 8e-10 At1g09180.1 68414.m01025 GTP-binding protein, putative strong si... 60 1e-09 At5g03530.1 68418.m00309 Ras-related GTP-binding family protein ... 39 0.003 At1g43890.1 68414.m05059 Ras-related GTP-binding protein, putati... 39 0.004 At2g42550.1 68415.m05266 protein kinase family protein contains ... 37 0.011 At1g02130.1 68414.m00139 Ras-related protein (ARA-5) / small GTP... 37 0.011 At1g02620.1 68414.m00212 GTP-binding protein (SAR1A) identical t... 37 0.015 At4g17170.1 68417.m02583 Rab2-like GTP-binding protein (RAB2) id... 36 0.026 At4g17160.1 68417.m02582 Ras-related GTP-binding protein, putati... 36 0.034 At3g53610.2 68416.m05922 Ras-related GTP-binding protein, putati... 35 0.045 At3g53610.1 68416.m05921 Ras-related GTP-binding protein, putati... 35 0.045 At5g03520.1 68418.m00308 Ras-related GTP-binding protein, putati... 35 0.060 At3g09900.1 68416.m01180 Ras-related GTP-binding protein, putati... 35 0.060 At5g59840.1 68418.m07503 Ras-related GTP-binding family protein ... 34 0.079 At4g35860.1 68417.m05093 Ras-related GTP-binding protein, putati... 34 0.079 At3g46060.1 68416.m04984 Ras-related protein (ARA-3) / small GTP... 34 0.079 At3g11730.1 68416.m01439 Ras-related GTP-binding protein, putati... 34 0.10 At5g47200.1 68418.m05820 Ras-related GTP-binding protein, putati... 33 0.14 At4g17530.1 68417.m02622 Ras-related GTP-binding protein, putati... 33 0.14 At3g46830.1 68416.m05083 Ras-related protein (RAB11A) / small GT... 32 0.32 At5g59150.1 68418.m07413 Ras-related GTP-binding protein, putati... 32 0.42 At4g39990.1 68417.m05663 Ras-related GTP-binding protein, putati... 31 0.97 At1g07410.1 68414.m00790 Ras-related GTP-binding protein, putati... 31 0.97 At2g31680.1 68415.m03867 Ras-related GTP-binding protein, putati... 30 1.3 At5g65270.1 68418.m08210 Ras-related GTP-binding family protein ... 30 1.7 At2g43130.1 68415.m05356 Ras-related protein (ARA-4) / small GTP... 30 1.7 At1g05810.1 68414.m00608 Ras-related protein (ARA-1) (ARA) / sma... 30 1.7 At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revo... 29 2.2 At5g47960.1 68418.m05925 Ras-related GTP-binding family protein ... 29 2.2 At5g47520.1 68418.m05867 Ras-related GTP-binding protein, putati... 29 2.2 At1g18200.1 68414.m02264 Ras-related GTP-binding family protein ... 29 3.0 At3g12160.1 68416.m01516 Ras-related GTP-binding family protein ... 29 3.9 At3g07410.1 68416.m00883 Ras-related GTP-binding family protein ... 29 3.9 At2g33870.1 68415.m04158 Ras-related GTP-binding protein, putati... 29 3.9 At4g16420.3 68417.m02486 transcriptional adaptor (ADA2b) identic... 28 5.2 At4g16420.2 68417.m02485 transcriptional adaptor (ADA2b) identic... 28 5.2 At4g16420.1 68417.m02484 transcriptional adaptor (ADA2b) identic... 28 5.2 At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly iden... 28 5.2 At1g09630.1 68414.m01080 Ras-related GTP-binding protein, putati... 28 5.2 At4g18800.1 68417.m02776 Ras-related GTP-binding family protein ... 28 6.8 At5g46170.1 68418.m05679 F-box family protein contains F-box dom... 27 9.0 At5g45130.1 68418.m05540 Ras-related protein (RHA1) / small GTP-... 27 9.0 At5g39730.1 68418.m04811 avirulence-responsive protein-related /... 27 9.0 At4g19640.1 68417.m02884 Ras-related GTP-binding protein, putati... 27 9.0 At1g73640.1 68414.m08525 Ras-related GTP-binding family protein ... 27 9.0 At1g60990.1 68414.m06867 glycine cleavage T family protein / ami... 27 9.0 At1g16920.1 68414.m02051 Ras-related GTP-binding protein, putati... 27 9.0 >At2g24765.1 68415.m02959 ADP-ribosylation factor 3 (ARF3) identical to GP:453191 ADP-ribosylation factor 3 {Arabidopsis thaliana}; contains domain PF00025: ADP-ribosylation factor family Length = 182 Score = 141 bits (341), Expect = 5e-34 Identities = 62/88 (70%), Positives = 74/88 (84%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 Y+LQ+GEVV+TIPTIGFNVE V Y N+KFQVWDLGGQTSIRPYWRCY+ NT A+IYVVDS Sbjct: 35 YRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAVIYVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 +D DRIG++K+E +L E+EL A L Sbjct: 95 SDTDRIGVAKEEFHAILEEDELKGAVVL 122 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/34 (61%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +3 Query: 156 MGGLFS-YFRGLLGAREMRILILGLDGAGKTTIL 254 MG LF+ F + G +E RIL+LGLD AGKTTIL Sbjct: 1 MGILFTRMFSSVFGNKEARILVLGLDNAGKTTIL 34 >At5g14670.1 68418.m01719 ADP-ribosylation factor, putative similar to ADP-ribosylation factor DcARF1 (GI:965483) [Daucus carota]. Length = 188 Score = 122 bits (294), Expect = 2e-28 Identities = 55/88 (62%), Positives = 68/88 (77%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +I+VVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DRDR+ ++DEL ML E+EL +A L Sbjct: 95 NDRDRVVEARDELHRMLNEDELRDAVLL 122 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 177 FRGLLGAREMRILILGLDGAGKTTILINCK 266 F L +EMRIL++GLD AGKTTIL K Sbjct: 9 FSRLFAKKEMRILMVGLDAAGKTTILYKLK 38 >At3g62290.1 68416.m06998 ADP-ribosylation factor identical to GP:166586 ADP-ribosylation factor {Arabidopsis thaliana}; ADP-ribosylation factor 1 - Arabidopsis thaliana, PIR:S28875 Length = 181 Score = 122 bits (294), Expect = 2e-28 Identities = 55/88 (62%), Positives = 68/88 (77%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +I+VVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DRDR+ ++DEL ML E+EL +A L Sbjct: 95 NDRDRVVEARDELHRMLNEDELRDAVLL 122 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 177 FRGLLGAREMRILILGLDGAGKTTILINCK 266 F L +EMRIL++GLD AGKTTIL K Sbjct: 9 FSKLFAKKEMRILMVGLDAAGKTTILYKLK 38 >At2g47170.1 68415.m05890 ADP-ribosylation factor 1 (ARF1) identical to ADP-ribosylation factor ARF1({Arabidopsis thaliana} (SP:P36397) (GP:166586) Length = 181 Score = 122 bits (294), Expect = 2e-28 Identities = 55/88 (62%), Positives = 68/88 (77%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +I+VVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DRDR+ ++DEL ML E+EL +A L Sbjct: 95 NDRDRVVEARDELHRMLNEDELRDAVLL 122 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 177 FRGLLGAREMRILILGLDGAGKTTILINCK 266 F L +EMRIL++GLD AGKTTIL K Sbjct: 9 FSRLFAKKEMRILMVGLDAAGKTTILYKLK 38 >At1g70490.3 68414.m08112 ADP-ribosylation factor, putative nearly identical to ADP-ribosylation factor 1 GB:P36397 [Arabidopsis thaliana], ADP-ribosylation factor GI:166586 [Arabidopsis thaliana] Length = 181 Score = 122 bits (294), Expect = 2e-28 Identities = 55/88 (62%), Positives = 68/88 (77%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +I+VVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DRDR+ ++DEL ML E+EL +A L Sbjct: 95 NDRDRVVEARDELHRMLNEDELRDAVLL 122 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 177 FRGLLGAREMRILILGLDGAGKTTILINCK 266 F L +EMRIL++GLD AGKTTIL K Sbjct: 9 FSRLFAKKEMRILMVGLDAAGKTTILYKLK 38 >At1g70490.2 68414.m08111 ADP-ribosylation factor, putative nearly identical to ADP-ribosylation factor 1 GB:P36397 [Arabidopsis thaliana], ADP-ribosylation factor GI:166586 [Arabidopsis thaliana] Length = 181 Score = 122 bits (294), Expect = 2e-28 Identities = 55/88 (62%), Positives = 68/88 (77%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +I+VVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DRDR+ ++DEL ML E+EL +A L Sbjct: 95 NDRDRVVEARDELHRMLNEDELRDAVLL 122 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 177 FRGLLGAREMRILILGLDGAGKTTILINCK 266 F L +EMRIL++GLD AGKTTIL K Sbjct: 9 FSRLFAKKEMRILMVGLDAAGKTTILYKLK 38 >At1g70490.1 68414.m08110 ADP-ribosylation factor, putative nearly identical to ADP-ribosylation factor 1 GB:P36397 [Arabidopsis thaliana], ADP-ribosylation factor GI:166586 [Arabidopsis thaliana] Length = 181 Score = 122 bits (294), Expect = 2e-28 Identities = 55/88 (62%), Positives = 68/88 (77%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +I+VVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DRDR+ ++DEL ML E+EL +A L Sbjct: 95 NDRDRVVEARDELHRMLNEDELRDAVLL 122 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 177 FRGLLGAREMRILILGLDGAGKTTILINCK 266 F L +EMRIL++GLD AGKTTIL K Sbjct: 9 FSRLFAKKEMRILMVGLDAAGKTTILYKLK 38 >At1g23490.1 68414.m02948 ADP-ribosylation factor identical to SP:Q9SRC3 ADP-ribosylation factor 1-like [Arabidopsis thaliana], ADP-ribosylation factor GI:166586 [Arabidopsis thaliana] Length = 181 Score = 122 bits (294), Expect = 2e-28 Identities = 55/88 (62%), Positives = 68/88 (77%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +I+VVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DRDR+ ++DEL ML E+EL +A L Sbjct: 95 NDRDRVVEARDELHRMLNEDELRDAVLL 122 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 177 FRGLLGAREMRILILGLDGAGKTTILINCK 266 F L +EMRIL++GLD AGKTTIL K Sbjct: 9 FSRLFAKKEMRILMVGLDAAGKTTILYKLK 38 >At1g10630.1 68414.m01205 ADP-ribosylation factor, putative similar to ADP-ribosylation factor GI:166586 from [Arabidopsis thaliana] Length = 181 Score = 122 bits (294), Expect = 2e-28 Identities = 55/88 (62%), Positives = 68/88 (77%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ IRP WR Y+ NT +I+VVDS Sbjct: 35 YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DRDR+ ++DEL ML E+EL +A L Sbjct: 95 NDRDRVVEARDELHRMLNEDELRDAVLL 122 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +3 Query: 177 FRGLLGAREMRILILGLDGAGKTTILINCK 266 F L +EMRIL++GLD AGKTTIL K Sbjct: 9 FSRLFAKKEMRILMVGLDAAGKTTILYKLK 38 >At5g17060.1 68418.m01999 ADP-ribosylation factor, putative similar to ADP-ribosylation factor 1; ARF 1 (GP:385340) {Drosophila melanogaster) Length = 192 Score = 117 bits (281), Expect = 9e-27 Identities = 49/88 (55%), Positives = 67/88 (76%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL +GEV++T+PTIGFNVE+V YKN+ F VWD+GGQ +RP WR Y+ NTD +IYVVDS Sbjct: 35 YKLHIGEVLSTVPTIGFNVEKVQYKNVMFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DR+RIG +K E ++++ + N+ L Sbjct: 95 LDRERIGKAKQEFQEIIKDPFMLNSIIL 122 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/34 (55%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +3 Query: 156 MGGLF-SYFRGLLGAREMRILILGLDGAGKTTIL 254 MG F F G +EMR+++LGLD AGKTTIL Sbjct: 1 MGQAFRKLFDTFFGNQEMRVVMLGLDAAGKTTIL 34 >At3g03120.1 68416.m00308 ADP-ribosylation factor, putative similar to ADP-ribosylation factor 1; ARF 1 (GP:385340) {Drosophila melanogaster} Length = 192 Score = 117 bits (281), Expect = 9e-27 Identities = 50/88 (56%), Positives = 67/88 (76%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL +GEV++T+PTIGFNVE+V YKN+ F VWD+GGQ +RP WR Y+ NTD +IYVVDS Sbjct: 35 YKLHIGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 DR+RIG +K E ++R+ + N+ L Sbjct: 95 LDRERIGKAKQEFQDIIRDPFMLNSVIL 122 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/34 (55%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +3 Query: 156 MGGLF-SYFRGLLGAREMRILILGLDGAGKTTIL 254 MG F F G +EMR+++LGLD AGKTTIL Sbjct: 1 MGQTFRKLFDTFFGNQEMRVVMLGLDAAGKTTIL 34 >At3g22950.1 68416.m02893 ADP-ribosylation factor, putative similar to ADP-ribosylation factor GB:P91924 [Dugesia japonica] Length = 183 Score = 111 bits (266), Expect = 6e-25 Identities = 50/93 (53%), Positives = 63/93 (67%) Frame = +2 Query: 239 KDDNSYKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAII 418 K YKL +GEVVTT PT+G NVE++ YKN++F+VWDLGGQ +R W YY T A+I Sbjct: 30 KTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEVWDLGGQDRLRTSWATYYRGTHAVI 89 Query: 419 YVVDSADRDRIGISKDELVHMLREEELANAXSL 517 V+DS DR RI KDEL +L E+L N+ L Sbjct: 90 VVIDSTDRARISFMKDELARLLGHEDLQNSVIL 122 Score = 31.9 bits (69), Expect = 0.42 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +3 Query: 156 MGGLFSYFRGLL-GAREMRILILGLDGAGKTTIL 254 MG S F ++ A+E +I+++GLD AGKTT L Sbjct: 1 MGAFMSRFWFMMFPAKEYKIVVVGLDNAGKTTTL 34 >At2g15310.1 68415.m01746 ADP-ribosylation factor, putative similar to ADP-ribosylation factor (GI:861205) [Chlamydomonas reinhardtii] Length = 205 Score = 105 bits (252), Expect = 3e-23 Identities = 46/88 (52%), Positives = 63/88 (71%) Frame = +2 Query: 254 YKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDS 433 YKL++GEVVTT+PTIGFN+E V YK + F VWD+GGQ IR WR Y+ N +I+VVDS Sbjct: 35 YKLKLGEVVTTVPTIGFNLETVEYKGINFTVWDIGGQEKIRKLWRHYFQNAQGLIFVVDS 94 Query: 434 ADRDRIGISKDELVHMLREEELANAXSL 517 +D +R+ +++EL +L + EL A L Sbjct: 95 SDSERLSEARNELHRILTDNELEGACVL 122 Score = 35.5 bits (78), Expect = 0.034 Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +3 Query: 156 MGGLFSYF-RGLLGAREMRILILGLDGAGKTTILINCK 266 MG FS + L ++RIL++GLDG+GKTTIL K Sbjct: 1 MGARFSRIAKRFLPKSKVRILMVGLDGSGKTTILYKLK 38 >At2g18390.1 68415.m02142 ADP-ribosylation factor-like protein 2 (ARL2) identical to ARL2 G-protein (Halimasch; HAL; TITAN5) GI:20514265 from [Arabidopsis thaliana]; identical to cDNA ARL2 G-protein mRNA GI:20514264; contains Pfam profile PF00025: ADP-ribosylation factor family; contains TIGRfam profile TIGR00231: small GTP-binding protein domain Length = 185 Score = 83.4 bits (197), Expect = 1e-16 Identities = 37/84 (44%), Positives = 56/84 (66%), Gaps = 1/84 (1%) Frame = +2 Query: 269 GEVVTTI-PTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 GE + I PT+GFN++ + Y+ +WD+GGQ +IR YWR Y+ TD +++VVDS+D Sbjct: 38 GEDTSVISPTLGFNIKTIIYQKYTLNIWDVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLR 97 Query: 446 RIGISKDELVHMLREEELANAXSL 517 R+ K EL ++L+EE LA + L Sbjct: 98 RLDDCKMELDNLLKEERLAGSSLL 121 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +3 Query: 162 GLFSYFRGLLGA-REMRILILGLDGAGKTTILI 257 GL S R + +EMRIL++GLD +GKTTI++ Sbjct: 2 GLLSIIRKIKKKEKEMRILMVGLDNSGKTTIVL 34 Score = 29.9 bits (64), Expect = 1.7 Identities = 22/66 (33%), Positives = 32/66 (48%) Frame = +1 Query: 481 VKGRRISERXLVVLANKQDMAGCLT*PRYTQALGLXTPCAIEXSQIL*DFSRXKAXGLDS 660 +K R++ L++LANKQD+ G LT + L L + +I+ S GL Sbjct: 110 LKEERLAGSSLLILANKQDIQGALTPDEIGKVLNLESMDKSRHWKIV-GCSAYTGEGLLE 168 Query: 661 GRMDWL 678 G DWL Sbjct: 169 G-FDWL 173 >At5g37680.1 68418.m04538 ADP-ribosylation factor, putative ADP-ribosylation factor, Leishmania major, EMBL:LMFP1421 and ADP-ribosylation factor-like protein 1 (ARL1) (SP:P40616) Homo sapiens; contains PF00025: ADP-ribosylation factor family Length = 184 Score = 77.0 bits (181), Expect = 1e-14 Identities = 33/71 (46%), Positives = 46/71 (64%) Frame = +2 Query: 287 IPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKD 466 IPT+GFN+ +VT N+ ++WDLGGQ R W Y AI+YV+D+ADRD + IS+ Sbjct: 49 IPTVGFNMRKVTKGNVTIKIWDLGGQRRFRTMWERYCRGVSAIVYVIDAADRDSVPISRS 108 Query: 467 ELVHMLREEEL 499 EL +L + L Sbjct: 109 ELNDLLTKPSL 119 >At3g49870.1 68416.m05452 ADP-ribosylation factor, putative similar to ADP-ribosylation factor-like protein 1 (SP:P40616) [Homo sapiens]; ARF3 ADP-RIBOSYLATION FACTOR,GP:453191 Arabidopsis thaliana; contains domain PF00025: ADP-ribosylation factor family Length = 184 Score = 74.5 bits (175), Expect = 6e-14 Identities = 33/71 (46%), Positives = 45/71 (63%) Frame = +2 Query: 287 IPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKD 466 IPT+GFN+ +VT N+ ++WDLGGQ R W Y AI+YVVD+AD D + +SK Sbjct: 49 IPTVGFNMRKVTKGNVTIKLWDLGGQPRFRSMWERYCRAVSAIVYVVDAADPDNLSVSKS 108 Query: 467 ELVHMLREEEL 499 EL +L + L Sbjct: 109 ELHDLLSKTSL 119 >At5g67560.1 68418.m08519 ADP-ribosylation factor, putative identical to GP:15450888 ADP-ribosylation factor-like protein {Arabidopsis thaliana] Length = 184 Score = 73.7 bits (173), Expect = 1e-13 Identities = 32/71 (45%), Positives = 46/71 (64%) Frame = +2 Query: 287 IPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKD 466 IPT+GFN+ +VT ++ ++WDLGGQ R W Y + AI+YVVD+AD D + +SK Sbjct: 49 IPTVGFNMRKVTKGSVTIKLWDLGGQPRFRSMWERYCRSVSAIVYVVDAADPDNLSVSKS 108 Query: 467 ELVHMLREEEL 499 EL +L + L Sbjct: 109 ELHDLLSKTSL 119 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 165 LFSYFRGLLGAREMRILILGLDGAGKTTIL 254 L ++ R L +EM + ++GL AGKT+++ Sbjct: 7 LLNWLRSLFFKQEMELSLIGLQNAGKTSLV 36 >At3g49860.1 68416.m05451 ADP-ribosylation factor, putative similar to GTP-binding ADP-ribosylation factor homolog 1 protein (SP:P25160) [Drosophila melanogaster] and various ADP-RIBOSYLATION FACTOR (ARF) - like proteins; contains PF00025: ADP-ribosylation factor family domain Length = 165 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/71 (42%), Positives = 44/71 (61%) Frame = +2 Query: 287 IPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKD 466 IPT+GFN+ +VT +N+ ++WDLGGQ R W Y I+YVVD+AD + + +S+ Sbjct: 30 IPTVGFNMRKVTKENVAIRLWDLGGQPRFRCMWERYCRAVSMIVYVVDAADTENLSVSRS 89 Query: 467 ELVHMLREEEL 499 EL +L L Sbjct: 90 ELHDLLSNASL 100 >At5g52210.2 68418.m06481 ADP-ribosylation factor, putative similar to arf-related protein (ARP) (SP:Q63055){Rattus norvegicus}; contains Pfam domain PF00025: ADP-ribosylation factor family Length = 205 Score = 68.1 bits (159), Expect = 5e-12 Identities = 31/77 (40%), Positives = 42/77 (54%) Frame = +2 Query: 287 IPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKD 466 +PT+G N+ ++ N K WDLGGQ +R W YY A+IY++D+A R SK Sbjct: 53 VPTVGLNIGRIEVSNAKIVFWDLGGQPGLRSIWEKYYEEAHALIYLIDAACPTRFEDSKS 112 Query: 467 ELVHMLREEELANAXSL 517 L LR E+L A L Sbjct: 113 ALEKALRHEDLQGAPLL 129 Score = 36.7 bits (81), Expect = 0.015 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 144 LINKMGGLFSYFRGLLGAREMRILILGLDGAGKTTILINCKSVRS 278 + + M GL+SY + E +LILG+D AGKTT L K++ S Sbjct: 1 MFSLMSGLWSY---MFSKTEFNVLILGIDKAGKTTFLEKLKTIYS 42 >At5g52210.1 68418.m06480 ADP-ribosylation factor, putative similar to arf-related protein (ARP) (SP:Q63055){Rattus norvegicus}; contains Pfam domain PF00025: ADP-ribosylation factor family Length = 205 Score = 68.1 bits (159), Expect = 5e-12 Identities = 31/77 (40%), Positives = 42/77 (54%) Frame = +2 Query: 287 IPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKD 466 +PT+G N+ ++ N K WDLGGQ +R W YY A+IY++D+A R SK Sbjct: 53 VPTVGLNIGRIEVSNAKIVFWDLGGQPGLRSIWEKYYEEAHALIYLIDAACPTRFEDSKS 112 Query: 467 ELVHMLREEELANAXSL 517 L LR E+L A L Sbjct: 113 ALEKALRHEDLQGAPLL 129 Score = 36.7 bits (81), Expect = 0.015 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 144 LINKMGGLFSYFRGLLGAREMRILILGLDGAGKTTILINCKSVRS 278 + + M GL+SY + E +LILG+D AGKTT L K++ S Sbjct: 1 MFSLMSGLWSY---MFSKTEFNVLILGIDKAGKTTFLEKLKTIYS 42 >At3g62560.1 68416.m07028 GTP-binding protein, putative similar to GTP-binding protein SAR1A (SP:O04834) [Arabidopsis thaliana]; small GTP-binding protein Bsar1a - Brassica campestris, EMBL:U55035 Length = 193 Score = 64.5 bits (150), Expect = 6e-11 Identities = 30/76 (39%), Positives = 45/76 (59%) Frame = +2 Query: 290 PTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDE 469 PT E+++ +KF+ +DLGG R W+ YY DA++Y+VD+ D++R SK E Sbjct: 50 PTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKE 109 Query: 470 LVHMLREEELANAXSL 517 L +L +E LAN L Sbjct: 110 LDALLSDESLANVPFL 125 Score = 32.3 bits (70), Expect = 0.32 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +3 Query: 189 LGAREMRILILGLDGAGKTTILINCKSVR 275 L +E +IL LGLD AGKTT+L K R Sbjct: 16 LWQKEAKILFLGLDNAGKTTLLHMLKDER 44 >At1g02440.1 68414.m00192 ADP-ribosylation factor, putative similar to ADP-ribosylation factor GB:AAA32729 GI:166586 from (Arabidopsis thaliana) Length = 190 Score = 62.9 bits (146), Expect = 2e-10 Identities = 32/86 (37%), Positives = 48/86 (55%), Gaps = 3/86 (3%) Frame = +2 Query: 224 IGRCRKDDNSYKLQVGEVVTT-IPTIGFNVEQVTYKNLKFQVWDLGGQTSIR--PYWRCY 394 +G K +K + GE +TT +PT+G NVE V YK+ W++GGQ P W+ + Sbjct: 25 LGGTGKSSIMHKFKTGETLTTTMPTVGLNVESVKYKDSNLCFWEMGGQQCYMWFPLWKHW 84 Query: 395 YGNTDAIIYVVDSADRDRIGISKDEL 472 + ++ VVDS RD+I +KD L Sbjct: 85 FQEIAGLVLVVDSTGRDQIEETKDFL 110 >At4g02080.1 68417.m00279 GTP-binding protein (SAR1A) identical to SP:O04834 GTP-binding protein SAR1A. [Arabidopsis thaliana] Length = 193 Score = 62.5 bits (145), Expect = 3e-10 Identities = 29/76 (38%), Positives = 45/76 (59%) Frame = +2 Query: 290 PTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDE 469 PT E+++ +KF+ +DLGG R W+ YY DA++Y+VD+ D++R SK E Sbjct: 50 PTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKE 109 Query: 470 LVHMLREEELANAXSL 517 L +L +E LA+ L Sbjct: 110 LDALLSDESLASVPFL 125 Score = 32.3 bits (70), Expect = 0.32 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +3 Query: 189 LGAREMRILILGLDGAGKTTILINCKSVR 275 L +E +IL LGLD AGKTT+L K R Sbjct: 16 LWQKEAKILFLGLDNAGKTTLLHMLKDER 44 >At1g56330.1 68414.m06475 GTP-binding protein (SAR1B) identical to GTP-binding protein (SAR1B) [Arabidopsis thaliana] SP:Q01474 Length = 193 Score = 61.3 bits (142), Expect = 6e-10 Identities = 29/76 (38%), Positives = 44/76 (57%) Frame = +2 Query: 290 PTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDE 469 PT E+++ +KF+ +DLGG R W+ YY DA++Y+VD+ D++R SK E Sbjct: 50 PTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRE 109 Query: 470 LVHMLREEELANAXSL 517 L +L +E LA L Sbjct: 110 LDALLSDEALATVPFL 125 Score = 35.9 bits (79), Expect = 0.026 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 5/42 (11%) Frame = +3 Query: 165 LFSYFRGLLGA-----REMRILILGLDGAGKTTILINCKSVR 275 LF +F G+L + +E +IL LGLD AGKTT+L K R Sbjct: 3 LFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDER 44 >At1g02430.1 68414.m00190 ADP-ribosylation factor, putative similar to ADP-ribosylation factor GI:166586 from [Arabidopsis thaliana] Length = 157 Score = 60.9 bits (141), Expect = 8e-10 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 3/82 (3%) Frame = +2 Query: 254 YKLQVGEVVTT-IPTIGFNVEQVTYKNLKFQVWDLGGQTSIR--PYWRCYYGNTDAIIYV 424 +KL+ GE +TT +PTIG +VE V YK+ + W++GGQ + P + + ++ V Sbjct: 2 HKLKTGETLTTTMPTIGTDVESVKYKDSNLRFWEMGGQQCYKWFPMTKHDFQEIAGLVLV 61 Query: 425 VDSADRDRIGISKDELVHMLRE 490 VDS DRDRI +KD L ++ E Sbjct: 62 VDSTDRDRIEDAKDFLNAVIDE 83 >At1g09180.1 68414.m01025 GTP-binding protein, putative strong similarity to SP:Q01474 GTP-binding protein SAR1B and SP:O04834 GTP-binding protein SAR1A [Arabidopsis thaliana] Length = 193 Score = 60.1 bits (139), Expect = 1e-09 Identities = 30/76 (39%), Positives = 43/76 (56%) Frame = +2 Query: 290 PTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDE 469 PT E+++ + F+ +DLGG R W+ Y DA++Y+VD+ DRDR SK E Sbjct: 50 PTQHPTSEELSIGKINFKAFDLGGHQIARRVWKDCYAKVDAVVYLVDAYDRDRFVESKRE 109 Query: 470 LVHMLREEELANAXSL 517 L +L +E LAN L Sbjct: 110 LDALLSDEALANVPCL 125 Score = 35.9 bits (79), Expect = 0.026 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 5/42 (11%) Frame = +3 Query: 165 LFSYFRGLLGA-----REMRILILGLDGAGKTTILINCKSVR 275 LF +F G+L + +E +IL LGLD AGKTT+L K R Sbjct: 3 LFDWFYGILASLGLCKKEAKILFLGLDNAGKTTLLHMLKDER 44 >At5g03530.1 68418.m00309 Ras-related GTP-binding family protein contains Pfam profile: PF00071 Ras family Length = 210 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = +2 Query: 290 PTIG--FNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 PTIG F ++Q+T K LK +WD GQ R YY II V D R+ Sbjct: 43 PTIGVDFKIKQLTVGGKRLKLTIWDTAGQERFRTLTSSYYRGAQGIILVYDVTRRE 98 >At1g43890.1 68414.m05059 Ras-related GTP-binding protein, putative similar to GTP-binding protein(RAB1Y) GI:1370173 from (Lotus japonicus) Length = 212 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/56 (41%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Frame = +2 Query: 290 PTIG--FNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 PTIG F V+ +T K LK +WD GQ R YY II V D RD Sbjct: 43 PTIGVDFKVKYLTIGEKKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRD 98 >At2g42550.1 68415.m05266 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 344 Score = 37.1 bits (82), Expect = 0.011 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 3/72 (4%) Frame = -2 Query: 367 GLSPKIPH---LELEIFICDLFYVEPNRRYSGHDLTDLQFIRIVVFPAPSNPSIKIRISL 197 G +P+IP + F+ F P R S DL QF+R V S P +K++I L Sbjct: 234 GKAPEIPKSLPCDARKFLETCFSRNPKERGSASDLLSHQFLRGEVVSGFSLPPLKLKIKL 293 Query: 196 APSNPLK*LNRP 161 AP P +P Sbjct: 294 APEKPTNVSKKP 305 >At1g02130.1 68414.m00139 Ras-related protein (ARA-5) / small GTP-binding protein, putative identical to Ras-related protein ARA-5 SP:P28188 from [Arabidopsis thaliana] Length = 203 Score = 37.1 bits (82), Expect = 0.011 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +2 Query: 236 RKDDNSYKLQVGEVVTTIPTIGFNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTD 409 R D+SY V ++TI + F + V K +K Q+WD GQ R YY Sbjct: 27 RFSDDSY---VESYISTIG-VDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAH 82 Query: 410 AIIYVVDSADRD 445 II V D D + Sbjct: 83 GIIIVYDVTDEE 94 >At1g02620.1 68414.m00212 GTP-binding protein (SAR1A) identical to GTP-binding protein Sar1 (SP:O04834) [Arabidopsis thaliana]; contains domain PF00025: ADP-ribosylation factor family Length = 122 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = +2 Query: 392 YYGNTDAIIYVVDSADRDRIGISKDELVHMLREEELANAXSL 517 ++ DA++Y+VD+ D++R SK EL +L +E LA L Sbjct: 13 WFSQVDALVYLVDAYDQERFAESKKELDALLSDESLATVPFL 54 >At4g17170.1 68417.m02583 Rab2-like GTP-binding protein (RAB2) identical to Rab2-like protein (At-RAB2) GI:1765896 from [Arabidopsis thaliana] Length = 211 Score = 35.9 bits (79), Expect = 0.026 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = +2 Query: 293 TIG--FNVEQVTYKN--LKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 TIG F +T N +K Q+WD GQ S R R YY + V D R+ Sbjct: 38 TIGVEFGARMITIDNKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRE 92 >At4g17160.1 68417.m02582 Ras-related GTP-binding protein, putative similar to GTP-binding protein GI:1208537 from [Glycine max] Length = 205 Score = 35.5 bits (78), Expect = 0.034 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +2 Query: 293 TIG--FNVEQVTYKN--LKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 TIG F + +T N +K Q+WD GQ S R R YY + V D R+ Sbjct: 38 TIGVEFGAKTITIDNKPIKLQIWDTAGQESFRSVTRSYYRGRAGTLLVYDITRRE 92 >At3g53610.2 68416.m05922 Ras-related GTP-binding protein, putative similar to Ras-related protein ARA-3 SP:P28186 from [Arabidopsis thaliana] Length = 216 Score = 35.1 bits (77), Expect = 0.045 Identities = 32/121 (26%), Positives = 52/121 (42%), Gaps = 2/121 (1%) Frame = +2 Query: 278 VTTIPTIGFNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRI 451 +TTI I F + + K +K Q+WD GQ R YY I+ V D D Sbjct: 45 ITTIG-IDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSF 103 Query: 452 GISKDELVHMLREEELANAXSLF*PTNRTWPDV*HSRGTPRPWGXGRLAR*XLPRFFKTS 631 ++ + ++ E+ +++ + N+ D R P+ G LA +FF+TS Sbjct: 104 NNIRNWIRNI--EQHASDSVNKILVGNKADMDE-SKRAVPKSKGQA-LADEYGMKFFETS 159 Query: 632 A 634 A Sbjct: 160 A 160 >At3g53610.1 68416.m05921 Ras-related GTP-binding protein, putative similar to Ras-related protein ARA-3 SP:P28186 from [Arabidopsis thaliana] Length = 216 Score = 35.1 bits (77), Expect = 0.045 Identities = 32/121 (26%), Positives = 52/121 (42%), Gaps = 2/121 (1%) Frame = +2 Query: 278 VTTIPTIGFNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRI 451 +TTI I F + + K +K Q+WD GQ R YY I+ V D D Sbjct: 45 ITTIG-IDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSF 103 Query: 452 GISKDELVHMLREEELANAXSLF*PTNRTWPDV*HSRGTPRPWGXGRLAR*XLPRFFKTS 631 ++ + ++ E+ +++ + N+ D R P+ G LA +FF+TS Sbjct: 104 NNIRNWIRNI--EQHASDSVNKILVGNKADMDE-SKRAVPKSKGQA-LADEYGMKFFETS 159 Query: 632 A 634 A Sbjct: 160 A 160 >At5g03520.1 68418.m00308 Ras-related GTP-binding protein, putative similar to GTP-binding protein GI:871508 from [Pisum sativum] Length = 216 Score = 34.7 bits (76), Expect = 0.060 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +2 Query: 278 VTTIPTIGFNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSAD 439 +TTI I F + V K +K Q+WD GQ R YY I+ V D D Sbjct: 45 ITTIG-IDFKIRTVELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTD 99 >At3g09900.1 68416.m01180 Ras-related GTP-binding protein, putative similar to GTP-binding protein GI:871510 from [Pisum sativum]; contains Pfam profile: PF00071 Ras family Length = 218 Score = 34.7 bits (76), Expect = 0.060 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +2 Query: 278 VTTIPTIGFNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSAD 439 +TTI I F + V K +K Q+WD GQ R YY I+ V D D Sbjct: 45 ITTIG-IDFKIRTVELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTD 99 >At5g59840.1 68418.m07503 Ras-related GTP-binding family protein contains Pfam profile: PF00071 Ras family Length = 216 Score = 34.3 bits (75), Expect = 0.079 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +2 Query: 278 VTTIPTIGFNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSAD 439 +TTI I F + + K +K Q+WD GQ R YY I+ V D D Sbjct: 45 ITTIG-IDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTD 99 >At4g35860.1 68417.m05093 Ras-related GTP-binding protein, putative similar to Rab2-like GTP-binding protein GI:1765896 from [Arabidopsis thaliana] Length = 211 Score = 34.3 bits (75), Expect = 0.079 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = +2 Query: 293 TIG--FNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 TIG F VT + +K Q+WD GQ S R R YY + V D R+ Sbjct: 38 TIGVEFGARMVTVDGRPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRE 92 >At3g46060.1 68416.m04984 Ras-related protein (ARA-3) / small GTP-binding protein, putative identical to SP|P28186 Ras-related protein ARA-3 {Arabidopsis thaliana}; contains Pfam profile: PF00071 Ras family Length = 216 Score = 34.3 bits (75), Expect = 0.079 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +2 Query: 278 VTTIPTIGFNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSAD 439 +TTI I F + + K +K Q+WD GQ R YY I+ V D D Sbjct: 45 ITTIG-IDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTD 99 >At3g11730.1 68416.m01439 Ras-related GTP-binding protein, putative similar to Rab1-like small GTP-binding protein GI:4096662 from [Petunia x hybrida] Length = 205 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = +2 Query: 287 IPTIG--FNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 I TIG F + + K +K Q+WD GQ R YY II V D + + Sbjct: 38 ISTIGVDFKIRTIEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTEME 94 >At5g47200.1 68418.m05820 Ras-related GTP-binding protein, putative similar to GTP-binding protein GI:303750 from [Pisum sativum] Length = 202 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Frame = +2 Query: 287 IPTIG--FNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSAD 439 I TIG F + V K +K Q+WD GQ R YY II D D Sbjct: 38 ISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTD 92 >At4g17530.1 68417.m02622 Ras-related GTP-binding protein, putative very strong similarity to RAB1C [Lotus corniculatus var. japonicus] GI:1370166; contains Pfam profile PF00071: Ras family Length = 202 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Frame = +2 Query: 287 IPTIG--FNVEQVTY--KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSAD 439 I TIG F + V K +K Q+WD GQ R YY II D D Sbjct: 38 ISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTD 92 >At3g46830.1 68416.m05083 Ras-related protein (RAB11A) / small GTP-binding protein, putative identical to SP|Q96283 Ras-related protein Rab11A {Arabidopsis thaliana}; identical to cDNA Rab11 protein GI:2598228 Length = 217 Score = 32.3 bits (70), Expect = 0.32 Identities = 19/59 (32%), Positives = 24/59 (40%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDELVHMLRE 490 QV K +K Q+WD GQ R YY + V D R D ++ LRE Sbjct: 55 QVEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTF----DNVLRWLRE 109 >At5g59150.1 68418.m07413 Ras-related GTP-binding protein, putative similar to Ras-related protein Rab11C SP:Q40193 from [Lotus japonicus] Length = 217 Score = 31.9 bits (69), Expect = 0.42 Identities = 19/59 (32%), Positives = 24/59 (40%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRDRIGISKDELVHMLRE 490 QV K +K Q+WD GQ R YY + V D R D ++ LRE Sbjct: 55 QVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTF----DNVLRWLRE 109 >At4g39990.1 68417.m05663 Ras-related GTP-binding protein, putative similar to GTP-binding protein GI:303738 from [Pisum sativum] Length = 224 Score = 30.7 bits (66), Expect = 0.97 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +2 Query: 317 VTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADRD 445 + K++K Q+WD GQ R YY + V D R+ Sbjct: 61 IEQKSIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRE 103 >At1g07410.1 68414.m00790 Ras-related GTP-binding protein, putative similar to GTP-binding protein RAB11C GI:1370146 from [Lotus japonicus] Length = 214 Score = 30.7 bits (66), Expect = 0.97 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 QV K +K Q+WD GQ R YY + V D R Sbjct: 55 QVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKR 97 >At2g31680.1 68415.m03867 Ras-related GTP-binding protein, putative similar to GTP-binding protein GI:289370 from [Brassica napus] Length = 219 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR---DRIGISKDEL 472 ++ K +K Q+WD GQ R YY + V D + R + +G DEL Sbjct: 55 EIEGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDEL 110 >At5g65270.1 68418.m08210 Ras-related GTP-binding family protein similar to GTP-binding protein RAB11A GI:1370142 from [Lotus japonicus]; contains Pfam profile: PF00071 Ras family Length = 226 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 317 VTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 + +K++K Q+WD GQ R YY + V D R Sbjct: 61 IDHKSVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITRR 102 >At2g43130.1 68415.m05356 Ras-related protein (ARA-4) / small GTP-binding protein, putative identical to SP:P28187 Ras-related protein ARA-4 {Arabidopsis thaliana} Length = 214 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +2 Query: 326 KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD---SADRDRIGISKDEL 472 K +K Q+WD GQ R YY + V D S+ + +G DEL Sbjct: 59 KEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDEL 110 >At1g05810.1 68414.m00608 Ras-related protein (ARA-1) (ARA) / small GTP-binding protein, putative nearly identical to SP:P19892 Ras-related protein ARA-1 [Arabidopsis thaliana] (Gene 76:313-319(1989)) Length = 261 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR---DRIGISKDEL 472 ++ K +K Q+WD GQ R YY + V D R + +G DEL Sbjct: 98 EIEGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDEL 153 >At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revoluta (REV) / fascicular fiberless 1 (IFL1) identical to HD-zip transcription factor Revoluta (GI:9759333) {Arabidopsis thaliana}; contains Pfam profiles PF01852: START domain and PF00046: Homeobox domain Length = 842 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 298 WVQRRTSHI*KSQVPSVGSWGTDQY*ALLAMLLWQHRCNNICCRLS*Q 441 W+ + SH S++ ++ S G+D + LLW H+ +CC L Q Sbjct: 698 WISQSYSHHLGSELLTIDSLGSDDS---VLKLLWDHQDAILCCSLKPQ 742 >At5g47960.1 68418.m05925 Ras-related GTP-binding family protein contains Pfam profile: PF00071 Ras family Length = 223 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 ++ K +K Q+WD GQ R YY + V D R Sbjct: 58 EIDRKTIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKR 100 >At5g47520.1 68418.m05867 Ras-related GTP-binding protein, putative similar to GTP-binding protein RAB11J GI:1370160 from [Lotus japonicus] Length = 221 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 326 KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 K +K Q+WD GQ R YY + V D + R Sbjct: 61 KEIKAQIWDTAGQERFRAVTSAYYRGAVGALLVYDISRR 99 >At1g18200.1 68414.m02264 Ras-related GTP-binding family protein contains Pfam profile: PF00071 Ras family Length = 354 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Frame = +2 Query: 290 PTIGFNVE----QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 PTIG + +V K +K Q+WD GQ R YY + + D R Sbjct: 44 PTIGVDFAYRNVRVGDKTIKAQIWDTAGQERFRAITSSYYRGALGALLIYDITRR 98 >At3g12160.1 68416.m01516 Ras-related GTP-binding family protein similar to ras-related GTP-binding protein RGP1 SP:P25766 from [Oryza sativa];contains Pfam profile: PF00071 Ras family Length = 222 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 Query: 326 KNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 K +K Q+WD GQ R YY + V D R Sbjct: 62 KTVKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKR 100 >At3g07410.1 68416.m00883 Ras-related GTP-binding family protein contains Pfam profile: PF00071 Ras family Length = 217 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 ++ K +K Q+WD GQ R YY + V D Sbjct: 55 EIEGKEVKAQIWDTAGQERFRAVTSAYYRGAFGALIVYD 93 >At2g33870.1 68415.m04158 Ras-related GTP-binding protein, putative similar to GTP-binding protein GI:303742 from [Pisum sativum] Length = 219 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 QV K +K Q+WD GQ R YY + V D Sbjct: 57 QVDDKIVKAQIWDTAGQERYRAITSAYYRGAVGALLVYD 95 >At4g16420.3 68417.m02486 transcriptional adaptor (ADA2b) identical to transcriptional adaptor ADA2b [Arabidopsis thaliana] gi|13591700|gb|AAK31320 Length = 486 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +2 Query: 182 RIAGCKGNADFDTWIGRCRKDDNSYKLQVGE 274 ++AGC+ A+ + ++GR RK +N + G+ Sbjct: 351 QVAGCRSTAEAERYLGRKRKRENEEGMNRGK 381 >At4g16420.2 68417.m02485 transcriptional adaptor (ADA2b) identical to transcriptional adaptor ADA2b [Arabidopsis thaliana] gi|13591700|gb|AAK31320 Length = 483 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +2 Query: 182 RIAGCKGNADFDTWIGRCRKDDNSYKLQVGE 274 ++AGC+ A+ + ++GR RK +N + G+ Sbjct: 348 QVAGCRSTAEAERYLGRKRKRENEEGMNRGK 378 >At4g16420.1 68417.m02484 transcriptional adaptor (ADA2b) identical to transcriptional adaptor ADA2b [Arabidopsis thaliana] gi|13591700|gb|AAK31320 Length = 487 Score = 28.3 bits (60), Expect = 5.2 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +2 Query: 182 RIAGCKGNADFDTWIGRCRKDDNSYKLQVGE 274 ++AGC+ A+ + ++GR RK +N + G+ Sbjct: 352 QVAGCRSTAEAERYLGRKRKRENEEGMNRGK 382 >At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly identical to SP|P12411 Tubulin beta-1 chain {Arabidopsis thaliana} Length = 447 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 Query: 325 ICDLFYVEPNRRYSGHDLTDLQFIRIVVF 239 ICD V+P RY+G D DLQ RI V+ Sbjct: 24 ICDEHGVDPTGRYNG-DSADLQLERINVY 51 >At1g09630.1 68414.m01080 Ras-related GTP-binding protein, putative similar to GTP-binding protein GI:1370146 from [Lotus japonicus] Length = 217 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 QV + +K Q+WD GQ R YY + V D Sbjct: 55 QVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYD 93 >At4g18800.1 68417.m02776 Ras-related GTP-binding family protein similar to ras-related GTP binding protein RIC2 SP:P40393 from [Oryza sativa]; contains Pfam profile: PF00071 Ras family Length = 214 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +2 Query: 317 VTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 V K +K Q+WD GQ R YY + V D Sbjct: 57 VNEKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYD 94 >At5g46170.1 68418.m05679 F-box family protein contains F-box domain Pfam:PF00646 Length = 395 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/56 (25%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +2 Query: 242 DDNSYKLQVGEVVTTIPT-IGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNT 406 DD+ +++ G V PT + N +++ Y ++ +LG + WR +G+T Sbjct: 144 DDDGGEIEQGGVTHHSPTQVLKNFDEIRYLRIELPSGELGIDDGVLLKWRAEFGST 199 >At5g45130.1 68418.m05540 Ras-related protein (RHA1) / small GTP-binding protein identical to Ras-related protein RHA1 SP:P31582 from [Arabidopsis thaliana] Length = 200 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 Query: 332 LKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 +KF++WD GQ YY A I V D Sbjct: 59 VKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFD 91 >At5g39730.1 68418.m04811 avirulence-responsive protein-related / avirulence induced gene (AIG) protein-related similar to SP|P54121 AIG2 protein {Arabidopsis thaliana} Length = 172 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/91 (25%), Positives = 39/91 (42%) Frame = +2 Query: 242 DDNSYKLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIY 421 + N Y+ EVV + VE TY + D+GG+ + R + Sbjct: 83 EGNEYERVFVEVVRKDNSEKMRVE--TYPWINKNDPDIGGEWDFEEWKRLHMKTFIEAFT 140 Query: 422 VVDSADRDRIGISKDELVHMLREEELANAXS 514 + R+ G +D+ ++L+EE+ ANA S Sbjct: 141 EIMERKRNPQGKGRDDFSNVLKEEDPANAPS 171 >At4g19640.1 68417.m02884 Ras-related GTP-binding protein, putative similar to GTP-binding protein RAB5A GI:1370178 from [Lotus japonicus] Length = 200 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 Query: 332 LKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVD 430 +KF++WD GQ YY A I V D Sbjct: 59 VKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFD 91 >At1g73640.1 68414.m08525 Ras-related GTP-binding family protein contains Pfam profile: PF00071 ras family Pfam profile: PF00071 Ras family Length = 233 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = +2 Query: 290 PTIG----FNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 PTIG + V K +K Q+WD GQ R YY + + D R Sbjct: 44 PTIGVEFAYRNVHVGDKIIKAQIWDTAGQERFRAITSSYYRGALGALLIYDITRR 98 >At1g60990.1 68414.m06867 glycine cleavage T family protein / aminomethyl transferase family protein contains Pfam profile: PF01571 glycine cleavage T-protein (aminomethyl transferase) Length = 423 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 416 IYVVDSADRDRIGISKDELVHMLREEELANAXSLF 520 + VVD + RI +S D+ H L + AN SL+ Sbjct: 104 VVVVDLSHFGRIRVSGDDRAHFLHNQTTANFESLY 138 >At1g16920.1 68414.m02051 Ras-related GTP-binding protein, putative similar to GTP binding protein GI:218228 from [Vicia faba]; identical to cDNA small GTP-binding protein (Rab11) GI:451859 Length = 216 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = +2 Query: 314 QVTYKNLKFQVWDLGGQTSIRPYWRCYYGNTDAIIYVVDSADR 442 +V K +K Q+WD GQ R YY + V D R Sbjct: 56 KVDGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRR 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,051,074 Number of Sequences: 28952 Number of extensions: 316437 Number of successful extensions: 822 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -