BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30927.Seq (419 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40226-1|AAB01760.1| 76|Drosophila melanogaster L43 protein. 65 3e-11 AE013599-3176|AAF46708.1| 76|Drosophila melanogaster CG10071-P... 65 3e-11 AE013599-3175|AAM70864.1| 76|Drosophila melanogaster CG10071-P... 65 3e-11 AE013599-3174|AAM70863.1| 76|Drosophila melanogaster CG10071-P... 65 3e-11 AY075553-1|AAL68360.1| 56|Drosophila melanogaster RH58777p pro... 63 2e-10 AE013599-1923|AAF58230.1| 3257|Drosophila melanogaster CG12864-P... 29 3.3 AE013599-1922|AAO41391.1| 1633|Drosophila melanogaster CG12864-P... 29 3.3 AE014296-847|AAF47899.1| 604|Drosophila melanogaster CG15020-PA... 27 7.7 >U40226-1|AAB01760.1| 76|Drosophila melanogaster L43 protein. Length = 76 Score = 65.3 bits (152), Expect = 3e-11 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = +3 Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344 MAKSKNHTNHNQN+KAHRNGIK+P + RHE L F + +AR+ S+ + + R Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59 Query: 345 LREKL-PEKQRPR 380 E++ +K +P+ Sbjct: 60 YNERIASQKGKPK 72 >AE013599-3176|AAF46708.1| 76|Drosophila melanogaster CG10071-PC, isoform C protein. Length = 76 Score = 65.3 bits (152), Expect = 3e-11 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = +3 Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344 MAKSKNHTNHNQN+KAHRNGIK+P + RHE L F + +AR+ S+ + + R Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59 Query: 345 LREKL-PEKQRPR 380 E++ +K +P+ Sbjct: 60 YNERIASQKGKPK 72 >AE013599-3175|AAM70864.1| 76|Drosophila melanogaster CG10071-PB, isoform B protein. Length = 76 Score = 65.3 bits (152), Expect = 3e-11 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = +3 Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344 MAKSKNHTNHNQN+KAHRNGIK+P + RHE L F + +AR+ S+ + + R Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59 Query: 345 LREKL-PEKQRPR 380 E++ +K +P+ Sbjct: 60 YNERIASQKGKPK 72 >AE013599-3174|AAM70863.1| 76|Drosophila melanogaster CG10071-PA, isoform A protein. Length = 76 Score = 65.3 bits (152), Expect = 3e-11 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = +3 Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344 MAKSKNHTNHNQN+KAHRNGIK+P + RHE L F + +AR+ S+ + + R Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59 Query: 345 LREKL-PEKQRPR 380 E++ +K +P+ Sbjct: 60 YNERIASQKGKPK 72 >AY075553-1|AAL68360.1| 56|Drosophila melanogaster RH58777p protein. Length = 56 Score = 62.9 bits (146), Expect = 2e-10 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPL 263 MAKSKNHTNHNQN+KAHRNGIK+P + RHE L Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTL 33 >AE013599-1923|AAF58230.1| 3257|Drosophila melanogaster CG12864-PA, isoform A protein. Length = 3257 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 135 FPLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTR 248 FP+QD ++ KM+K + H N +N K + K + R Sbjct: 2256 FPVQDAEIEKMSKGRGHQNAVKNTKTEQPKSKPKTEVR 2293 >AE013599-1922|AAO41391.1| 1633|Drosophila melanogaster CG12864-PB, isoform B protein. Length = 1633 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 135 FPLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTR 248 FP+QD ++ KM+K + H N +N K + K + R Sbjct: 632 FPVQDAEIEKMSKGRGHQNAVKNTKTEQPKSKPKTEVR 669 >AE014296-847|AAF47899.1| 604|Drosophila melanogaster CG15020-PA protein. Length = 604 Score = 27.5 bits (58), Expect = 7.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 222 HFCELCGFGYDLYDSLTLPF 163 HF C +GYD + ++T PF Sbjct: 313 HFKVTCEYGYDFWKTVTFPF 332 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,545,143 Number of Sequences: 53049 Number of extensions: 271537 Number of successful extensions: 803 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1271883306 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -