BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30921.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 3.7 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 3.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.4 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 8.5 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 628 LLVFAGITDLLDGWI 584 ++ FAG+ DLL W+ Sbjct: 78 VMTFAGVNDLLGYWV 92 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 237 LKVLCGITAASTIVSAVSYLVSKDT 163 + L I+A+ I A S LVSKD+ Sbjct: 242 INTLLSISASCVIAFATSALVSKDS 266 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 591 PSSKSVIPANTNSPQCQVVIILGLLP 668 P S +P NTNS + IL ++P Sbjct: 767 PPSAQNVPQNTNSQAIPRIPILPMIP 792 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 629 PPVPGCNYS 655 PPVPG NY+ Sbjct: 1654 PPVPGSNYN 1662 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = -2 Query: 646 TTWHWGLLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADK 521 T + W + AG + + + + +NW T S L+ +K Sbjct: 414 TPFQWDNSINAGFSKIAENLLEKNWLPVHTSYKSGLNLEQEK 455 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,723 Number of Sequences: 438 Number of extensions: 4811 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -