BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30921.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04870.1 68417.m00709 CDP-alcohol phosphatidyltransferase fam... 49 3e-06 At3g55030.1 68416.m06111 phosphatidylglycerolphosphate synthase,... 44 1e-04 At2g39290.1 68415.m04824 phosphatidylglycerolphosphate synthase ... 43 2e-04 At1g68000.1 68414.m07768 CDP-diacylglycerol--inositol 3-phosphat... 32 0.42 At4g38570.1 68417.m05460 CDP-diacylglycerol--inositol 3-phosphat... 30 1.3 At3g53480.1 68416.m05904 ABC transporter family protein PDR5-lik... 30 1.7 At1g06100.1 68414.m00639 fatty acid desaturase family protein si... 30 1.7 At5g17300.1 68418.m02026 myb family transcription factor similar... 28 6.8 At1g78980.1 68414.m09209 leucine-rich repeat transmembrane prote... 28 6.8 At2g27035.1 68415.m03248 plastocyanin-like domain-containing pro... 27 9.0 >At4g04870.1 68417.m00709 CDP-alcohol phosphatidyltransferase family protein similar to SP|Q07560 Cardiolipin synthetase (EC 2.7.8.-) {Saccharomyces cerevisiae; contains Pfam profile PF01066: CDP-alcohol phosphatidyltransferase Length = 341 Score = 48.8 bits (111), Expect = 3e-06 Identities = 29/84 (34%), Positives = 49/84 (58%), Gaps = 2/84 (2%) Frame = -1 Query: 500 ISLTWQDLIPISLTLLIVGRDIALVVAGFVIRYISLPPP-RTLSRYFDVTHATAQ-LAPT 327 +++ +DL+ L +++ RD+ALV +R ++L +T S +F++ ++ Q + P Sbjct: 216 VAMVQKDLLHPGLVGIVLLRDVALVGGAVYLRALNLDWKWKTWSDFFNLDGSSPQKVEPL 275 Query: 326 FISKVNTAVQLLLVGTTLASPVFG 255 FISKVNT QL LV + P FG Sbjct: 276 FISKVNTVFQLTLVAGAILQPEFG 299 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/38 (52%), Positives = 28/38 (73%) Frame = -2 Query: 625 LVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLV 512 L +G +D LDG++AR K S +GS+LDP+ADKVL+ Sbjct: 175 LAVSGASDWLDGYVARRMKINSV-VGSYLDPLADKVLI 211 >At3g55030.1 68416.m06111 phosphatidylglycerolphosphate synthase, putative similar to phosphatidylglycerolphosphate synthase GI:13365519 from [Arabidopsis thaliana]; contains non-consensus CG acceptor splice site at exon 4 Length = 233 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/40 (50%), Positives = 30/40 (75%) Frame = -2 Query: 628 LLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVA 509 + + A ITD LDG+IAR + ++ G+FLDP+ADK++VA Sbjct: 76 IFIAAAITDWLDGYIARKMR-LGSEFGAFLDPVADKLMVA 114 >At2g39290.1 68415.m04824 phosphatidylglycerolphosphate synthase (PGS1) identical to phosphatidylglycerolphosphate synthase GI:13365519 from [Arabidopsis thaliana] Length = 296 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/46 (47%), Positives = 31/46 (67%) Frame = -2 Query: 646 TTWHWGLLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVA 509 TT + + A ITD LDG++AR + S G+FLDP+ADK++VA Sbjct: 134 TTATTSIFIAAAITDWLDGYLARKMRLGSA-FGAFLDPVADKLMVA 178 >At1g68000.1 68414.m07768 CDP-diacylglycerol--inositol 3-phosphatidyltransferase / phosphatidylinositol synthase (PIS1) identical to phosphatidylinositol synthase (PIS1) GB:AJ000539 [gi:3367632] Length = 227 Score = 31.9 bits (69), Expect = 0.42 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -2 Query: 628 LLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVA 509 L F+ D +DGW+AR + ST G+ LD + D+V A Sbjct: 47 LYFFSFCCDAVDGWVARRFNQVST-FGAVLDMVTDRVSTA 85 >At4g38570.1 68417.m05460 CDP-diacylglycerol--inositol 3-phosphatidyltransferase, putative / phosphatidylinositol synthase, putative similar to phosphatidylinositol synthase (PIS1) - Arabidopsis thaliana, PID:e1313354 [gi:3367632] Length = 225 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -2 Query: 628 LLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVA 509 L F+ D +DGW AR + ST G+ LD + D+V A Sbjct: 44 LYFFSFCCDAVDGWCARKFNQVST-FGAVLDMVTDRVSTA 82 >At3g53480.1 68416.m05904 ABC transporter family protein PDR5-like ABC transporter, Spirodela polyrrhiza, EMBL:Z70524 Length = 1450 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +1 Query: 4 LIIYLHYFV*LIK*TVLLMVNKILKTIKNNLEMGIEIFHNTSRYSYFF 147 L++ +YFV + K L+M I T+ MGI+I H S S F Sbjct: 536 LLMKRNYFVYIFKTAQLVMAAFITMTVFIRTRMGIDIIHGNSYMSALF 583 >At1g06100.1 68414.m00639 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 299 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 327 SRCKLCGCVCYIEIPTQRSRWW*AYISNDKSSHN 428 S C +CG + T R+ WW A ++ +S HN Sbjct: 214 SACHICGSQAWQTNDTSRNVWWLALLTMGESWHN 247 >At5g17300.1 68418.m02026 myb family transcription factor similar to CCA1 [Arabidopsis thaliana] GI:4090569; contains Pfam profile PF00249: Myb-like DNA-binding domain Length = 387 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 480 VLPSERDKESATRTLSAIGSK 542 V PSERD +S T LS +GS+ Sbjct: 148 VSPSERDTQSPTSVLSTVGSE 168 >At1g78980.1 68414.m09209 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 2 GI:3360291 from [Zea mays] Length = 693 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -1 Query: 395 LPPPRTLSRYFDVTHATAQLAPTFISKVNTAVQLLL 288 L PP++LSR+ D+ Q+ P F ++ V+ L+ Sbjct: 632 LYPPKSLSRFADIIALCVQVEPEFRPPMSEVVEALV 667 >At2g27035.1 68415.m03248 plastocyanin-like domain-containing protein low similarity to SP:P80728 Mavicyanin {Cucurbita pepo}; contains Pfam profile PF02298: Plastocyanin-like domain Length = 163 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +1 Query: 319 LIKVGASCAVACVTSKYLLNVRGGGKLIYRMTNP 420 +++V S CV + Y+ N+ GG+ ++++ P Sbjct: 69 ILQVNKSSYEQCVDNDYIFNITRGGRDVFQLLEP 102 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,090,810 Number of Sequences: 28952 Number of extensions: 309423 Number of successful extensions: 641 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -