BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30912.Seq (597 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_51176| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 686 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 275 INATDIKVKEVDFN-PEFISRVIPKLDWEVLWVAADSIGHSDGLPRSLE 418 + T ++ +++FN P F S VI L W + W D+ H G R E Sbjct: 73 VRYTSQRIMKMNFNHPGFTSIVISMLHWRLFWPGKDT--HGGGKERERE 119 >SB_51176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 474 SNKTL*AFFKNSSFSSYLFSKDLGRPSLWP 385 SN T+ + F N S YLF +D P WP Sbjct: 21 SNDTM-SRFSNDKISRYLFEEDRQIPDKWP 49 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,837,071 Number of Sequences: 59808 Number of extensions: 321365 Number of successful extensions: 748 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -