BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30891.Seq (499 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78413-6|CAB01658.1| 144|Caenorhabditis elegans Hypothetical pr... 182 2e-46 >Z78413-6|CAB01658.1| 144|Caenorhabditis elegans Hypothetical protein T01C3.6 protein. Length = 144 Score = 182 bits (442), Expect = 2e-46 Identities = 82/140 (58%), Positives = 107/140 (76%) Frame = +1 Query: 16 IQAVQVFGRKKTATAVAYCKRGHGMLRVNGRPXDLVXPRLLQYKLXEPILLLGKEKFSXV 195 +Q+VQ FGRKKTATAVA+CK+G G+++VNGRP + + P++L+ KL EP+LL+GKE+F V Sbjct: 5 VQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKERFQDV 64 Query: 196 XIRVTVKGXGHVAQVYAIRQLFQRL*FAFYQKYVDEASKKGIKDILVPYDRSXLVAXPXR 375 IR+ V G GHVAQ+YA+RQ + A+Y KYVDE SK+ +K+I YD+S LVA P R Sbjct: 65 DIRIRVSGGGHVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVADPRR 124 Query: 376 CEPQKFGGPGAXARXQKSXR 435 E +KFGGPGA AR QKS R Sbjct: 125 RESKKFGGPGARARYQKSYR 144 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,976,736 Number of Sequences: 27780 Number of extensions: 168293 Number of successful extensions: 294 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -